(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE21

PENCW_13.PE21        Location/Qualifiers
FT   CDS_pept        complement(48729..50006)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945514"
FT                   /orf_name="Pc16g00210"
FT                   /product="Pc16g00210 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92691.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI0001831DB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S6"
FT                   /transl_table=1
FT                   /translation="MRLLSSLASRPHALSGAVQPARRSHLTWRLYSSTPAAKNRPLPLA
FT                   GVTVVSLEQAIAAPFCTRQLADLGARVIKVERPGVGDFARHYDTRVGGLASHFVWTNRS
FT                   KESLALDLKHEKDHAVLMKLLEKADVLVQNLAPGASARLGLSHEALKGEHPDLIVCDIS
FT                   GYGQDGPYRDKKAYDLLIQNEAGMLSVTGTGKEPVKVGISIADIAAGMYAYSNILSALL
FT                   QRGKDGQGCHIDISMLESMVEWMGFPMYYAFDNAPGPVPAGASHAAIYPYGPFEAGDGQ
FT                   SVMLGIQNEREWVSFCNGVLSQPDLATDPRFSSNSQRTQNRDELKSIIHDAFSKFTTTE
FT                   TIARLDEASIANATVNDMKDVWGHAQLQARDRWTKVQTPVGAIPALLPPGSTNSAGRDG
FT                   HGAQMGSVPRVGEHNEAIFAELGLSN"
     atgagattat tatcctcact tgcctcccgg ccccatgccc tgtcgggcgc agttcaacct        60
     gcaagacgat cacatctcac atggcgtctt tactccagca caccagctgc taaaaacagg       120
     cctctgcctc tcgctggggt tactgtggtc agtctcgagc aagctattgc tgcgcccttt       180
     tgcacgcgac agcttgccga tcttggagct cgagtcatca aggtcgaacg gccaggtgtt       240
     ggagactttg cacgacacta tgacacgcga gttggtggtc tagcatcaca tttcgtatgg       300
     acgaaccgtt ctaaggagag tttggctctg gacctcaaac acgaaaagga ccatgccgtc       360
     ctgatgaagc tccttgaaaa ggccgacgtt ctcgttcaga acttggcccc aggagccagt       420
     gcgcgactgg gcctttctca cgaggcattg aaaggggaac accctgatct tatagtgtgc       480
     gatatatctg gatatgggca agacggtcca tatcgcgaca agaaggccta cgaccttctt       540
     attcaaaatg aggctggaat gctctccgtc acgggcactg gaaaagagcc ggtaaaggtt       600
     ggtatctcta tcgctgatat tgctgcgggg atgtacgcct acagcaatat tctctcggca       660
     ctactgcagc gtggtaaaga tggacaaggt tgtcatattg acatctctat gctggaaagc       720
     atggtggaat ggatgggctt ccccatgtac tatgcattcg acaatgcccc gggtccagtc       780
     ccagcaggtg cctcgcatgc agccatctac ccttatggac cgttcgaagc tggtgatggc       840
     cagtcggtta tgttgggcat tcaaaatgag cgcgaatggg tcagtttctg caacggcgtc       900
     ctctcacaac cagatctggc caccgaccct agattttcca gcaactcaca acgaactcaa       960
     aatcgggatg agctcaagtc cattattcac gatgcattct cgaagtttac gacaactgaa      1020
     acaattgctc ggttggacga agcatctatc gccaacgcta ctgtcaatga catgaaagat      1080
     gtatggggcc atgctcagct tcaggcacga gatcgatgga ccaaggttca aacccctgta      1140
     ggggctattc cggctctttt gcctcctgga tcaaccaatt cagcgggaag agatggacat      1200
     ggcgctcaga tgggttcagt tccacgggtc ggagagcaca atgaggccat ttttgcggag      1260
     ctgggtttat caaattga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page