(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE210

PENCW_13.PE210       Location/Qualifiers
FT   CDS_pept        join(484008..484056,484113..484152,484237..484253,
FT                   484310..484736,484787..484844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946630"
FT                   /orf_name="Pc16g02100"
FT                   /product="Pc16g02100 protein"
FT                   /function="N-methyltransferase activity"
FT                   /biological_process="phospholipid metabolic process "
FT                   /protein_id="CAP92880.1"
FT                   /db_xref="GO:0006644"
FT                   /db_xref="GO:0008170"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniParc:UPI00018317B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H782"
FT                   /transl_table=1
FT                   /translation="MASLTDFVDFSSKPLLWSAATIAFNPIFWNIVARAEYRNHFLTRL
FT                   FGGAYNGCYFLAFTIFSLGILRDHLYQLALADQPFYAPVHQPIVGGVLFAIGSVLVLSS
FT                   MWALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYQGKVAGILLT
FT                   AQVFVLYWFALGWEDPFTAEIYAKRERERAKKQ"
     atggcctctc ttacagattt tgtcgatttt tcttctaagc ctttactatg gtccgccgcg        60
     actattgctt ttaacccaat tttctggaac attgttgccc gcgcagagta ccgcaaccac       120
     ttcttgactc gcctctttgg aggcgcgtac aatggctgct acttcctagc attcaccatc       180
     ttctccctcg ggattctccg tgaccatctc taccaactcg ctctagctga ccagcccttc       240
     tacgcacctg tccaccaacc gattgttgga ggtgtcttgt ttgctatcgg ttcggtcctg       300
     gttctctcca gcatgtgggc tcttggtgtg accggtacct accttggcga ctactttggt       360
     attctcatgg acgctcccgt cactgggttc cctttcaacg tgaccggctc gccgatgtac       420
     tggggtagca ccttgaactt cctcggtgtt gcactttacc agggcaaggt tgctggcatt       480
     cttttgaccg cccaggtctt tgtcctgtac tggttcgctc ttggctggga agaccccttc       540
     actgctgaga tctacgccaa gcgtgagcgc gagcgcgcca agaagcagta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page