(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE211

PENCW_13.PE211       Location/Qualifiers
FT   CDS_pept        join(487422..487544,487585..487851)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671373"
FT                   /orf_name="Pc16g02110"
FT                   /product="Putative uncharacterized protein Pc16g02110 "
FT                   /protein_id="CAP92881.1"
FT                   /db_xref="UniParc:UPI00018317B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H783"
FT                   /transl_table=1
FT                   /translation="MEILKDENLTVNVTSTETPAHRTHFSAMPGEEIQIPAGIVALQRR
FT                   GGYDLKAVIGTQDEAQTKEQTYDADSKIEGEDEDNTNDKGEERQNQDSGTWTISPCTHC
FT                   LLPKWTCVPYWDGPWTFQLSFYYVD"
     atggaaatcc tgaaagatga gaatttgacc gtcaatgtga catcaaccga aacccctgcc        60
     catagaacac atttctcggc tatgccaggg gaagaaatac agatacctgc tggaattgtg       120
     gcactgcaga ggcggggtgg ttatgacctc aaggctgtca taggcacgca ggacgaggct       180
     cagaccaagg aacaaaccta cgatgctgat tccaagattg agggagaaga tgaggacaat       240
     accaatgata agggcgagga aaggcaaaat caagatagtg gcacgtggac aatctcacca       300
     tgcacgcatt gtctgctccc caagtggact tgcgtgccct actgggatgg cccatggaca       360
     ttccagttgt cattttacta cgtggattaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page