(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE213

PENCW_13.PE213       Location/Qualifiers
FT   CDS_pept        join(complement(493946..494239),complement(492259..493870),
FT                   complement(492085..492198),complement(491752..492032),
FT                   complement(490267..491715))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671374"
FT                   /orf_name="Pc16g02130"
FT                   /product="Pc16g02130 protein"
FT                   /protein_id="CAP92883.1"
FT                   /db_xref="InterPro:IPR012880"
FT                   /db_xref="InterPro:IPR021773"
FT                   /db_xref="UniParc:UPI0001831889"
FT                   /db_xref="UniProtKB/TrEMBL:B6H784"
FT                   /transl_table=1
FT                   /translation="MDAYPEDYVNHNLPLVLLSGLEADTENEPGTPSDYPLLSEKGTHI
FT                   FSDFPPLSGAVAEELRSLLLEEDSSQSPWKSRVTVSGNTTIANIGYRIKSSGRSCRLPP
FT                   QKADPPIPSPPTTPSDDHDNEHSEPSAHYVLHSPISPLSPGSPTFPDGLLTPLWVTKHQ
FT                   DLVPAAVINFFPFSLDPNMNSLRDNQLKIEINSLKKEWQSSGYKTRFVVVLLSEDGEEG
FT                   GYEGEIDDRIAGIRRATNLDPRSIFVIPPDATSSELQDFVKSLFSLLQPSVVEYYRDLS
FT                   KHARRKRNRGNIPPPTAPPTTGTSQTLSSQGWNVRYEFKLGIFAEFRQEMDAACRNYES
FT                   AYETLFGHEVFENIAGWNPRFNDARLLADALAIRIIRCLLWTGQTTTAARLWVDHRVRV
FT                   KDIVDRRGKGSKHYGWEAWEARWSMVMAQLIRRAEIPPISSEISSEQPRKLYALPEKSI
FT                   PTGERVRPWEHLHHEGYWLHRSAKHTMLRRALAQEIPLEDRKPPGQSPASQLANKSYLY
FT                   DTYLVPDAHAEAPQEGRTGFDHSGLILSTLKAAIEEFAKRDQTRKVESLSLEAAEEYMR
FT                   IGSWSEAHGLLRPLWSTLSWRRSGWWHLMANFGRALRECALRMQDSETILRVDWELLNK
FT                   NLKPRSAWHYDIHKSLESLPSEKPKPSLILRAEDVITSLTASLVFEKSDGNVGEPLHAQ
FT                   LAITSCAHKFSAPIRLSEVKLVFEGCLRPVKVQSDQNQDADTTTSCCIATLPLREPSNA
FT                   DTAVQSPAGGLTALTKVFDLTCVPREAGEARVASITMLIEEEQFDLGYAVTEPEQRESF
FT                   WWEQTQKGVTRRRVGKDRDTGRCKVMPKPPKIRLTTPNLKRTYYTNERVMLQIGIHNEE
FT                   DEAADISAEIRLFGTESAAQIQWLDGDSNPELLESGASTPIEGPSHYLKRSVGVLERSS
FT                   QKTLTIVLVDTQEATDFTLEVSTVYHLVSDTQTPIMKNTTVDLSFIRPFEANYEFLPAI
FT                   HPQPWPNFFAVSDNLLEDGSAPSPGGLFQKWYLNSKVVSFALEPLVIDKMSLVLLEANG
FT                   GVVCDVHSEELVTPGTPHLAPEELRESNFCLDVQKLLLGDRRPTALTCTLEINWRRQSS
FT                   ESVASSDAENSVTTTVLDIPRFVVPMGEPRVLASATPSSSMAGLIHMGYVLENPSTHFL
FT                   TFNLVMEASEHFAFSGPKTTVVQLVPLSRHTVNFNLFAAKRGLWIQPQLVVIDTYFNKT
FT                   LRVLPTGDMRSDKKGVLVWVDADD"
     atggacgcct accccgaaga ctacgtcaat cacaatctgc ctttagtcct actctcaggg        60
     ctggaggcag acactgaaaa tgagccagga acaccatcgg attatcctct gctatcagag       120
     aaggggacgc atatcttctc agacttccca cctctgagcg gggctgttgc ggaggagctc       180
     cggagcttgc ttctagagga agatagctct caatcgccat ggaagtctag agttactgta       240
     agcgggaata ctacgattgc gaatattggt taccgcatca aaagttctgg ccgctcatgc       300
     agactccctc cacaaaaagc tgacccccct atcccctcac caccaactac tcccagtgat       360
     gaccatgata atgaacactc cgagcctagc gcacactatg tcctccactc cccgatatcg       420
     cctctgtcac cgggttcccc aactttccca gatggcttgc tcacacctct atgggtaact       480
     aaacaccagg acctggttcc agcagcagtg ataaatttct tcccgttttc gctggaccca       540
     aatatgaact cgctgcgaga caatcaactc aagatcgaga tcaatagctt gaaaaaagaa       600
     tggcaatcct ccgggtacaa gacgcggttc gtggtcgttc tgttatcaga agacggagaa       660
     gaaggcggct atgagggcga gattgatgac cgaattgcgg ggattcggcg ggcaacaaac       720
     cttgacccca ggtcaatatt tgtgattcca ccagacgcga cttcatcgga actgcaagac       780
     tttgtgaaat cactcttctc tttactgcaa ccgtcggttg ttgaatacta tcgggatctg       840
     tcaaagcatg ccaggcgtaa acggaacagg gggaatatcc cccctccgac cgcaccacca       900
     acgaccggaa cttctcagac cctatcgtcc caaggctgga acgtacggta tgaattcaag       960
     cttggaattt ttgccgagtt tcgccaagaa atggatgcag cctgccggaa ctatgagagt      1020
     gcgtacgaaa ccctgtttgg gcatgaagtc ttcgaaaata ttgcaggctg gaatcctcga      1080
     ttcaacgatg cgcgcctttt ggccgacgcc ctggccattc ggattatacg ctgcctgcta      1140
     tggacgggcc agacgaccac tgcagctcgg ctttgggttg accacagagt ccgtgtaaag      1200
     gatattgtcg atcgcagagg aaagggcagt aaacactacg ggtgggaggc ctgggaggcg      1260
     cgttggtcga tggtaatggc acagcttatc cgccgagcgg aaattccgcc tatctccagc      1320
     gaaatctctt ctgagcagcc cagaaagctc tatgctctac ctgagaaatc gattccaacc      1380
     ggggaaagag tcaggccctg ggaacatctc catcacgagg gttactggct acaccgttca      1440
     gcgaaacata cgatgttgcg acgtgccctt gcccaggaaa tccccttgga agatcgcaag      1500
     ccccccgggc aatcacccgc ctcacaactc gcaaataaat cctacttgta cgacacgtac      1560
     cttgttcccg acgctcacgc cgaagcaccc caagaaggac gaactggctt cgaccattct      1620
     ggtctaatat taagcacgct gaaggctgct atcgaggaat tcgcaaaacg cgaccaaaca      1680
     aggaaagtcg agagcttgag tcttgaggcg gccgaggagt atatgcgtat tggctcatgg      1740
     tccgaagcgc atggccttct tcggccgctg tggtctactc ttagctggcg ccgctcaggg      1800
     tggtggcatc tgatggccaa tttcgggcgg gcgctcagag aatgtgccct caggatgcag      1860
     gacagcgaga caatcttgcg agtggactgg gagctgttga ataagaatct caaacctaga      1920
     tctgcgtggc attatgacat ccacaagagt cttgaaagtt taccctcaga aaagcctaaa      1980
     ccttctctta tccttcgcgc agaggatgtt ataacaagtc tgaccgcgtc gctggtgttc      2040
     gagaaatctg atggcaacgt tggcgaacct ctacatgcac agcttgccat cacatcctgt      2100
     gctcataaat tctcggcgcc tattcggctt tcggaggtca aactggtttt cgaaggatgt      2160
     cttcgaccgg taaaggttca atctgaccag aaccaggatg ctgacaccac aacctcatgt      2220
     tgtatcgcaa ctcttccact ccgggaaccg agcaacgctg atactgcggt tcaatcccca      2280
     gccggtggac tgaccgcatt gaccaaggtg tttgacctca cctgtgttcc tcgcgaagct      2340
     ggtgaagcca gggttgcttc aatcaccatg ctgattgaag aagaacaatt cgatttgggt      2400
     tatgcggtca ctgaaccaga acagcgtgaa tcgttctggt gggagcagac ccagaagggc      2460
     gtgacccgta ggagagtggg caaggatagg gatactggca ggtgcaaggt tatgcctaag      2520
     cctcccaaga tccgcctcac aactcccaac ctgaagcgga cctactacac caatgaacga      2580
     gtgatgcttc agattggtat acacaatgaa gaagacgaag ctgccgatat atctgctgag      2640
     atcagactat tcggcaccga gtccgcagct caaatccagt ggctcgacgg cgacagcaac      2700
     cccgaactcc tcgaatcagg cgccagcact ccgattgagg ggccgtctca ttacttgaaa      2760
     cgatctgtgg gtgttctgga gcgctcctcc cagaaaactc ttacaattgt gttggtcgat      2820
     acccaggagg ctacggattt caccttggaa gtttcgactg tgtaccattt ggtgtctgat      2880
     acccagaccc cgattatgaa gaatactacc gtggatctat catttattcg gccgtttgaa      2940
     gcaaactatg aattcttgcc ggcaattcac cctcagccat ggcccaattt cttcgcagtt      3000
     agcgacaact tactcgagga tggctctgcg ccaagtcctg gaggcctgtt ccagaaatgg      3060
     tacctcaatt ccaaggtagt ttcctttgca ctggagccat tggtaattga caagatgtcc      3120
     ctggttcttc tcgaagccaa cgggggagtc gtttgcgatg ttcactcaga ggagcttgtg      3180
     actcccggaa caccacatct cgcaccggaa gaactgcgag aatccaactt ctgcctcgat      3240
     gtccagaagc tccttctcgg agaccgccgg ccaactgcgc tcacctgcac attggagatc      3300
     aattggcgcc ggcagtcatc tgaatctgta gcttcctcgg acgcagagaa ctcagtcaca      3360
     accaccgtcc ttgatattcc ccgatttgtg gtcccaatgg gcgaacctcg agtccttgca      3420
     tcagccaccc catccagcag tatggcgggg ttgattcata tgggctatgt actggagaac      3480
     ccctccaccc atttcctcac cttcaacctg gtcatggaag ctagcgagca ctttgccttt      3540
     agcggaccga agaccaccgt tgtgcagctt gtgccgctga gtcgccacac agtgaacttc      3600
     aatttgtttg cagcgaagcg tggcttatgg attcagccac aactggtagt tattgatacc      3660
     tacttcaaca aaacgctccg cgtccttcca acgggggata tgaggtcgga caagaagggg      3720
     gttctggtat gggttgatgc cgacgattga                                       3750
//

If you have problems or comments...

PBIL Back to PBIL home page