(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE214

PENCW_13.PE214       Location/Qualifiers
FT   CDS_pept        join(495350..497147,497196..498124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824078"
FT                   /orf_name="Pc16g02140"
FT                   /product="Pc16g02140 protein"
FT                   /protein_id="CAP92884.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000183188A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H785"
FT                   /transl_table=1
FT                   /translation="MSNENPVQAESALLSRRRRRKSLPSRNGTDPTSPEVISSLISSLS
FT                   TISVPLNSHFDTIPKIDNESDPGLPEVPHTAPVYSIPPSEQHGFGMSYGAYKPTVEPPA
FT                   LPENPFLHPDDAASSPVIRMARAPPSPKSPRSPRFKPFRTADSSSTRPASRESYTSVIA
FT                   APEPSSFGTISTEPGPRLSTPSIASNSSAGRTKSLKGQLSLLKRSSREFVGEKDPQIER
FT                   LRKTTSYNDSLRHNVPRSRASLRSLHSMAEVTEEARPADVKEEPYEEKVASTPTKDYQS
FT                   FHGTPDASNPGGIGSGRIIPTRDSSLRHRHSQSSSSKKHRSARHSRYSSTASKEFNTDN
FT                   GLPGTSNDAEQVTRRIQEVKDQQQKIKTELEVGNSPEHSTKASPAKQAKPSKVSRVLGY
FT                   DVNQAMQNGPRRDRPSFNESAPSPNVMTGKSRTGSRPGAPLAPKSTHLPSQLPKSSVER
FT                   PDSERARYRQSLEPITPITHRRTPSGHLSHLSNGRPSYSTERPSSADSIDLAVDDYIFS
FT                   PKLTQRVIHPTTGRSIAFSEVGNPKGHVVLCCVGMGLTRYLMAFYDELARTLNLRLVTL
FT                   DRPGVGESGPHQGDEPSTPLSWPDDVAIVCNHLRVTKFSILAHSAGAIYALATALRIPQ
FT                   HIRGRIHLLAPWIPPSQLSNIGSKKEPAPTNAVPYSQKILRALPTSLLKVANSSFMSAT
FT                   SASITTSLPKSPRRAKRKAATKEASNATAIPPVPPIPSVDPNPQTPRVDIVPNIKPSAS
FT                   NTASYRKSDATLGSRAKSPEDEVERQRDYDTRLTYKIWELATTNANPAVDLLTCLERRQ
FT                   TIGFRYVDITRSVVIHHGSKDPRVPAENVQWLGKTMRRCEVRILEGEGHGLMASAGVMG
FT                   NVLTEIAKEWEDWTILVQGKRRATVSHAARPGLSIQT"
     atgtcgaacg aaaatcccgt gcaagcagag tcggctctgc ttagtcggcg tcggcgtcgt        60
     aaatcgctcc cttcgcgcaa tgggaccgat ccaacctcgc ctgaagtcat ttcctccctc       120
     atttcctccc tttccaccat ctccgtacct ctaaactccc actttgacac catcccgaag       180
     atcgacaacg aatcagaccc aggattgcca gaagtaccgc acaccgcgcc agtgtactcc       240
     attccgccat ccgagcagca tgggtttgga atgagttacg gtgcctacaa accaacggtc       300
     gagccacccg cgctaccgga gaacccattt ctacaccccg atgatgcggc ctcgtcgcct       360
     gtcattcgca tggcccgggc acccccgtca ccaaagtccc cccgatcgcc gagattcaaa       420
     ccgttcagaa cggccgactc atcgtccact cgcccagctt caagggaatc ttatacatct       480
     gtgatagccg ctcctgagcc ttcctcattc ggaacgatca gcacggagcc tggtccccgt       540
     ctgtcgaccc cgagcattgc gtcgaatagt tctgcagggc ggacaaaaag cctaaagggt       600
     caattgagtc tattgaagag gtcatcacgg gaattcgtgg gcgaaaagga tccacaaatc       660
     gagcgcctac gaaagactac tagctacaac gacagtctac gacacaacgt cccgcgcagc       720
     cgagcaagct tgcgctcatt gcattccatg gcggaggtta cagaggaggc tcgccctgcg       780
     gacgtcaagg aagagccata cgaagagaaa gtcgcaagca ccccaaccaa agattaccaa       840
     tcgttccacg gtactccaga tgctagcaac cccggcggaa ttggaagcgg tagaatcatt       900
     ccaactcgcg actcatctct gcggcatcgg catagccagt cgtcaagctc gaaaaagcac       960
     cggtctgctc gtcatagtcg atactcgtct acagccagca aagagttcaa tacagacaat      1020
     ggattaccag ggacgagtaa tgacgcagag caggtgaccc gccgcatcca agaggtgaaa      1080
     gaccagcaac agaagatcaa gaccgagctg gaagtgggaa atagccctga acattccacc      1140
     aaggcgagcc ccgcgaagca ggcaaagcct tcaaaggtat cacgcgttct aggatatgat      1200
     gtcaatcagg ccatgcagaa tggaccacgt cgtgatcggc catctttcaa cgaaagtgct      1260
     ccttctccaa acgtgatgac agggaaaagt cgaactggga gccggccagg agcaccactc      1320
     gcaccgaagt ctacccacct accatcgcag ttgcccaagt catccgtgga aagaccagat      1380
     tccgagagag ctagatacag acagtccctg gagccaatta caccaatcac ccatcgccga      1440
     acgccatccg gtcacctgtc ccatctgtca aatggacgcc cctcgtacag tactgaacga      1500
     ccatccagtg cagattcaat tgatcttgct gttgacgact acatcttttc gccgaagctg      1560
     actcaaagag tgatccaccc aaccaccggc cgctccatcg ccttctccga agtcggtaat      1620
     cctaagggcc atgtcgtgct ttgctgtgtc ggcatgggtc tcactcggta tctgatggca      1680
     ttttatgatg agttggcccg gacactcaat ctacgactgg tcacattgga ccgccctggc      1740
     gttggcgaga gcggcccaca ccagggagac gagccgagca cccctctcag ctggcccgat      1800
     gatgttgcaa tcgtttgcaa ccacctccga gtgactaaat tttccatact tgcccattcc      1860
     gctggtgcaa tctacgccct tgcaacggct ctccgaattc cgcagcatat tcgtggtcgc      1920
     attcatctcc tagctccatg gattccccca tctcagctgt ccaacatcgg ctctaagaag      1980
     gagcccgcgc cgaccaacgc ggtgccttac tcccagaaga ttcttcgtgc tcttcccaca      2040
     tctctcctca aagtggccaa ttccagcttt atgagtgcca ctagtgccag catcaccacc      2100
     agtttaccca agtccccgcg acgggccaag cgcaaggctg ctaccaaaga agcttccaat      2160
     gcgaccgcca tccctccagt accgcccata ccttccgttg accccaaccc gcagaccccg      2220
     cgagttgaca ttgtaccgaa tatcaaaccg tccgcttcaa acaccgcgtc gtacagaaaa      2280
     agtgacgcga ctctcgggtc tcgcgcaaag tctccagagg acgaagtcga acgacaacgt      2340
     gactatgata ctcgtctcac ctacaagatc tgggagctgg ccaccaccaa cgccaacccg      2400
     gcagttgatt tgctgacctg cctcgagcgt cgccaaacaa ttggattccg ctacgtggat      2460
     atcacgcgat ctgtggtgat ccaccatggc agcaaagacc ctcgcgttcc agcggagaat      2520
     gtccagtggc ttggtaagac gatgcgccgc tgtgaggtcc gtatccttga aggtgaaggc      2580
     catggcctca tggcatctgc tggtgtcatg ggcaatgttt tgaccgagat tgccaaggag      2640
     tgggaggact ggacgatcct tgtccaaggc aaacgccgag caactgtcag ccatgctgca      2700
     cggcctggac tctcgatcca aacttga                                          2727
//

If you have problems or comments...

PBIL Back to PBIL home page