(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE215

PENCW_13.PE215       Location/Qualifiers
FT   CDS_pept        join(498906..498983,499054..499477,499545..499861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946631"
FT                   /orf_name="Pc16g02150"
FT                   /product="Pc16g02150 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP92885.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000183188B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H786"
FT                   /transl_table=1
FT                   /translation="MPSSQRRLRLVVIAVIALLFMVFYYTGDATKIQNQKFYRSTIDAM
FT                   KAKEQAKQAKAQEKIQHPVHAPGQNVAAGAGAGEKVPVAEVEKAAVPPATDNEDTEEVS
FT                   IAGRTKMTVPKKANQDTPSEVQSELKSEEEKEREEKAKREREEKERKEAEATTELNAIL
FT                   KRAPVIVFSKSYCPYSKKAKLILLEHYSIEPKPLVVELDQHPLGPYLQALLAQSTGRRT
FT                   VPNVLVSGKSIGGGDDIAALDQRDELASTLRQMGGKWIVDVSHHEVEKSL"
     atgccttctt cccaacggcg gcttcgactg gtcgtcattg cggtcatcgc gcttcttttc        60
     atggtctttt actacactgg cgatgccaca aaaatccaaa accaaaagtt ctaccggtcg       120
     accatcgacg caatgaaagc taaagagcaa gccaagcagg ccaaggccca agagaagatt       180
     cagcatcctg tacatgcgcc cggtcagaat gtcgctgccg gtgcgggtgc cggagaaaag       240
     gtgccggtcg ccgaggtgga gaaagctgct gttcctcctg ctacagataa tgaagatacg       300
     gaggaggtct cgattgcggg acggacgaag atgaccgttc ccaagaaggc gaaccaggat       360
     acgccgtcag aggttcagtc ggagctcaag agcgaggagg agaaggagcg cgaggagaaa       420
     gcgaagagag agcgcgagga gaaggagaga aaagaggccg aggcgacaac ggagctcaat       480
     gcgatcctta agcgggctcc agtgatcgtc ttctccaaat cctactgtcc ctacagcaag       540
     aaagccaagt tgatcttgct agaacactac tctatcgagc cgaaaccgct cgtagtcgaa       600
     ttggaccagc acccgcttgg accgtatctg caggccctcc tcgcacagag cacggggcgt       660
     cgcactgtgc ccaatgtgct tgtgagtggg aagagtatag gtggtggaga tgatattgcg       720
     gcattggatc agcgcgacga gctggcttcg acgctgcgac aaatgggtgg aaaatggatc       780
     gtggatgtgt cacaccacga ggttgagaaa tcactgtga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page