(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE219

PENCW_13.PE219       Location/Qualifiers
FT   CDS_pept        join(505768..506060,506122..506456,506513..506817,
FT                   506875..507046,507101..507306)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128412"
FT                   /orf_name="Pc16g02190"
FT                   /product="Pc16g02190 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92889.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183188F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H790"
FT                   /transl_table=1
FT                   /translation="MTSILEWLKRLFGKRLFNLEWLRSLFRRSLKFPVSFPKAGWAVIP
FT                   ADEKVEEEQMPGFYEQNYFLPVTMGEILLSRYQAVGKLGWGTTSTVWLVRDLEMNDYKA
FT                   LKLFALDVFAAEESAFYDQTKQGNQQHPGANRVRAKIGNVMIPRKDWMYYDDHLALVQT
FT                   PLGESLQDLQIRSAGERLDKLSIQSTIYQMLLALDYLHTECHLIHGDIKGDNIFQEIGD
FT                   KTRLDRYVQAEMENPSPRKFADDYPIYRSRPLEPASELGILQLGDFGASAQGDQPRNGK
FT                   ILQPGLYRSPEVVLKKEWNYPVDVWNLAVWAWCAFEGSPLFQCTDTSENKRSYSVSLHL
FT                   AQFTGLLGPPPPDLIEPDTISAEYFDKDGNLVAKDREVKMTSFEELEKHLEGEDKEMFL
FT                   DLMRGMITWRPEDRKTPKELIKHPWLQAMDTCFSQAN"
     atgacctcta ttttggaatg gctgaagaga ctcttcggca agaggctctt caacttggaa        60
     tggttgagga gcctcttcag aaggtctctc aagtttcctg tctctttccc aaaagccggc       120
     tgggctgtta ttcctgccga tgagaaagtc gaggaggaac agatgccagg cttttatgag       180
     caaaactact ttctccctgt cactatgggt gagattttgc tctcccggta tcaggctgtt       240
     ggtaaactcg gatggggaac tacatctacc gtttggttgg ttcgagatct cgaaatgaat       300
     gactataagg cattgaagct ttttgctctc gatgtatttg ctgctgagga atctgcattc       360
     tacgaccaga ccaaacaggg aaatcaacaa catcctggag caaatcgagt gagggcaaag       420
     ataggcaatg taatgattcc ccgaaaagac tggatgtact atgatgacca tttggccctt       480
     gtgcaaacgc ctctggggga gagtttgcaa gatctccaaa tacgttcggc gggtgagcgc       540
     ttggacaagc tctctatcca atcgaccata tatcagatgt tgctagcact ggactatctg       600
     cacacagaat gtcacttgat tcatggggat atcaaggggg ataatatctt ccaagagatc       660
     ggggacaaaa ctaggctcga cagatatgtc caggctgaga tggagaatcc ttcaccacga       720
     aagtttgcgg acgactatcc tatctatcgc tccaggccac ttgaaccagc atccgagttg       780
     ggcatactgc agcttggaga tttcggcgcc tccgcacaag gagaccagcc acgcaacggt       840
     aaaatcctcc agcctggtct ttatcgatcg cccgaggtgg tgctgaaaaa ggagtggaat       900
     tatccggttg atgtttggaa cttggctgtc tgggcctggt gtgcattcga gggcagtcca       960
     ctcttccaat gtaccgacac ctccgaaaac aagcgttctt actccgtctc tctacatctt      1020
     gcgcaattta ctgggttgct gggaccacca ccacctgatc tcatagagcc tgacaccatc      1080
     agtgccgagt actttgataa agacgggaat ttggtagcca aggaccgcga ggttaagatg      1140
     accagttttg aagagttgga gaaacatctt gaaggggagg acaaagagat gttcttggac      1200
     ttgatgaggg ggatgattac atggcgacca gaggatcgaa agaccccaaa ggagttgata      1260
     aaacatccat ggcttcaagc tatggatacc tgcttctcac aagccaactg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page