(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE22

PENCW_13.PE22        Location/Qualifiers
FT   CDS_pept        join(complement(53280..53403),complement(52751..53250),
FT                   complement(52620..52700),complement(52038..52558),
FT                   complement(51683..51871),complement(50594..51590))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671086"
FT                   /orf_name="Pc16g00220"
FT                   /product="Pc16g00220 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92692.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831DB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S8"
FT                   /transl_table=1
FT                   /translation="MLRRTTRASTACSWCHHRKVRCDASILGSPCTRCRQDGRSELRLQ
FT                   KGLLSRTHLMTSIRTSSSANPLPTHQSSGSDVTTGRKSNDQHQSPNHPALTSQLRAHGL
FT                   SLDDRSTSSPQSPNVPYTEYAFVDSQQLLSLPSEDVAFLASKGCLSLPASDAIDEFARQ
FT                   YFKRIHPLVPVLDEAKFWRIYRNNQPTGAKMSLLVLQSLIFTSCPFMSLETLRQCGFND
FT                   RRDARKQLYHRAKLLFELRTEKLPHANAQGAVLLTHYISAEDPQAGSLWVTRAIEHAIL
FT                   IDAQPSLLVEDVAISLKKRLWWSILLRDRSLCIGLRRRPQVTSSFYRWSDWLSIEDFGE
FT                   ELYQSRVYDYNTKRRLFGALQGQCELAVLLTDLVSLVFTHRKIPRRLLSMIEFQGLLSR
FT                   IKTIKKSLDDAARVDLAQYAAFVVEENLFYAEDMYNNLVREISNDLRDGVDGLSLVMEY
FT                   FSVNGYANSLPLSVLGYVGMPLVLAAIDLKLSPSRQEIEVRQRRLNSLSQIIRHSETLY
FT                   DVTDFVAVGTNHILQLAYMTTQNLFLGEKTAPLLSLDGVARQDSLVRTQRQERASDESM
FT                   SPKPNRSTSWQDAFIRCPRAYLLISACVDYSLEIGRLPSASGLPEIVRDLPIARLPWTS
FT                   DIPSSDSTTSLLSQMNQVQRESYPTSVRASVEERDVLETTTIESQPEKSFTPKTAQINH
FT                   YSSPDAFPYSTTPSLVTDEQLQYINGVAGQTTCESTAPNLDFMDFGDCERVSDNTTGAC
FT                   AVSIPLELIGHMQAECRFEQAAFDYGTTLPLPVEAIDSTLFDSFFYEAFE"
     atgttgcgac gcacaacaag agcatcaacg gcttgctcct ggtgccatca tcgcaaagtg        60
     cgctgcgatg cgtcaatcct cggttctcca tgtacccggt gtcgacaaga cggtcgaagt       120
     gaattgagac tgcagaaagg attgctctca cgcacccact taatgacctc tattaggacc       180
     tcaagctcgg caaacccgct tcccacgcat caaagctcag ggtcagacgt gaccactggc       240
     cgaaaatcca atgatcagca tcagtcaccc aatcatccag ctcttacttc gcagcttcgc       300
     gcccatggtc tcagcttgga tgatcgcagc acaagctcac cacaatcccc taatgtcccg       360
     tataccgaat acgcctttgt cgattcgcaa caactgctgt cgctcccttc tgaagatgta       420
     gcatttctcg catccaaggg ctgtttgagt ttgccagctt ctgacgcaat cgacgagttt       480
     gctcgacagt acttcaagcg cattcatcct ttagtgcctg tcttggacga ggctaagttc       540
     tggcgcattt atcgaaacaa ccaacctact ggtgctaaaa tgtctctcct tgtcttacag       600
     tcattgatct tcacgagctg tccgtttatg tctttggaaa cattgcgtca atgtggattt       660
     aatgatagga gggatgcgcg gaaacaattg taccacagag ctaagctatt attcgagttg       720
     aggaccgaaa agctgcctca tgcaaacgcc caaggcgcgg ttttacttac gcactatatc       780
     tctgcggaag acccccaggc tggaagtttg tgggtcacaa gggccatcga gcacgctata       840
     cttatcgacg ctcaaccatc tttactggtg gaagatgtgg ctatctcgct caagaaacga       900
     ctttggtggt ctatccttct tcgtgaccga agcctatgca ttggcctacg ccgccgtcct       960
     caggtgacct ccagctttta tagatggagt gactggctga gtatagagga tttcggtgaa      1020
     gagttgtatc aatctcgagt ctacgactat aacaccaaga ggcgcctatt cggcgccctt      1080
     caaggtcaat gtgagctagc ggtgctactc acagatctgg tgtctctagt cttcacccat      1140
     cgaaagatcc caagaagatt actatctatg attgaattcc agggcctctt gtcgagaata      1200
     aaaaccatca aaaaatcact tgacgacgca gcgcgagtgg atctggcgca atatgcggca      1260
     tttgttgtag aagaaaactt gttctacgcg gaagacatgt ataacaatct ggttcgggag      1320
     attagcaatg acctaaggga cggagttgac gggttaagtc tcgtgatgga atacttcagc      1380
     gtgaatggat atgctaatag tcttccgtta agtgtgcttg gatacgtcgg catgccactc      1440
     gtactggcag ctatagacct caagctatcc ccttctcgac aggagataga ggtaagacaa      1500
     cgacgtttga actcgttgag tcaaatcatc cgtcactcgg agacactcta cgatgtcact      1560
     gatttcgtcg ccgtcgggac caaccatatc ttgcagcttg cctatatgac gacacaaaac      1620
     ctcttcttgg gagagaaaac agctccatta ctttcattgg atggcgtggc gagacaagac      1680
     tctttagtcc gcacccagcg tcaggagagg gcttccgatg aatcaatgtc gcctaaaccg      1740
     aaccgctcaa cgagctggca agacgcgttc attcggtgcc cgagggcata tcttttgata      1800
     tcggcttgcg tggactacag cttagaaatt gggagactgc catccgcgag tggtcttcct      1860
     gaaattgttc gcgaccttcc tattgctcga cttccctgga catctgatat accttcatct      1920
     gactccacaa cctcactttt gagccaaatg aaccaagtgc agcgagagag ctaccccaca      1980
     agcgtgcgtg catctgttga agagcgagat gttttggaaa ctaccactat cgagagccag      2040
     cccgagaaga gcttcacccc gaaaacggcc caaatcaacc actactcgtc accagatgca      2100
     tttccctatt ccacaacgcc ttctttggtg acagatgaac aactgcaata catcaacggg      2160
     gtagcggggc aaacgacttg tgaaagtacc gcaccgaacc tagatttcat ggactttggc      2220
     gactgcgaac gtgtatcaga caacacgaca ggcgcttgtg ccgtgagtat tccattggaa      2280
     cttatcggtc acatgcaggc cgagtgccgg tttgagcaag cagcttttga ctatggtacc      2340
     actttacccc taccggttga agctattgac tcgacacttt ttgactcttt cttttacgaa      2400
     gcattcgaat aa                                                          2412
//

If you have problems or comments...

PBIL Back to PBIL home page