(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE221

PENCW_13.PE221       Location/Qualifiers
FT   CDS_pept        join(complement(511271..512759),complement(511175..511212))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946634"
FT                   /orf_name="Pc16g02210"
FT                   /product="Pc16g02210 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92891.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831891"
FT                   /db_xref="UniProtKB/TrEMBL:B6H792"
FT                   /transl_table=1
FT                   /translation="MALEKEISPSPSPQDHEKGTIENLQLDRLGYKQELRRNRSVLTLL
FT                   FQTLAMAAIPYGEGSPLLSAIYGGGPLSIFIGWIVVCLLDQCIALSLAELSSRYPTSAG
FT                   PYYWTFQISRKKTTLSFINAWIWLIGNWTITLSVNFGFASMLSATISIYHPTWSASSWQ
FT                   LLLIFYAVCLTSLAICIFANNHLPLVDTLCATWTLLTIIIILVALSIKADTGRHSVSYT
FT                   LSHYDKSFAGWGDFTFFIGLLPAAYTFSAIGMISSMAEECANPAIKVPRAIALSIPVGG
FT                   TAGLFFIIPICATLPPLQDIIDAPAGQALPYILARVMGSPAGGLGLVSLVLVITVFCSI
FT                   SITVAASRATWAVARDDAVPLARLWARVDQRWGVPVWALVLLTGIQMLLGLINLGSSSA
FT                   FTAFVSVGVIALATAYAIPIFLSLWYGRREVAKAPWNCGGVGWFVNVVALAWIAFELVL
FT                   FSMPMALPVTAVSMNYASVVFVGFMAISAVWYGVYARKYYKGPPESDALD"
     atggctctcg aaaaggaaat cagcccttct ccctcccccc aagatcatga gaagggtaca        60
     atcgagaacc tccaactaga ccgtctaggc tataagcaag aactacgtcg caaccgctca       120
     gtcctaaccc tcctcttcca aacgcttgcc atggcagcaa ttccctacgg cgaaggctcg       180
     cctctcctct ccgccatcta cggcggcggt ccgctttcaa tcttcatagg ctggatagtc       240
     gtctgcctcc tcgaccagtg cattgcccta tccctcgcag aactctcttc gcgctaccca       300
     acctcggcag gcccctacta ctggaccttc cagatctccc gcaagaagac aactctctcc       360
     ttcatcaacg cctggatctg gctaatcggc aactggacca taaccctctc tgtaaacttc       420
     ggcttcgcct ccatgctctc agcaacaatc tcaatctacc atccaacatg gtcagcatcc       480
     agctggcaac tcctcctaat cttctacgca gtctgcctca cctccctagc aatctgcatc       540
     ttcgcaaata atcacctccc cctagtcgac accctctgcg caacctggac cctcctcaca       600
     ataataatca tcctagtcgc cctgtcgatc aaagcagaca caggccgcca ctcagtatca       660
     tataccctat cccactacga caaatccttc gccggctggg gagacttcac cttcttcatc       720
     ggcctcctcc cagccgcata caccttctcc gcaataggaa tgatctcctc aatggcagaa       780
     gagtgcgcga accctgcaat aaaagtcccc cgcgctatag ccctctccat ccccgtcggc       840
     ggaacagcag gcctattctt catcatcccg atctgcgcaa ccctaccccc tctacaagac       900
     atcatagacg ccccagccgg tcaggccctc ccttacatcc tagctcgtgt aatgggttcc       960
     ccggccggcg gtctgggcct cgtctccctt gttctggtca tcacggtctt ctgctcgatt      1020
     agtataacag ttgccgcgtc gcgcgcaacc tgggccgtgg cccgcgatga cgccgtcccg      1080
     ttggcgagac tgtgggcgcg tgtcgaccag cgctggggcg tgccggtctg ggcgttggtt      1140
     ttgttgacgg ggattcagat gttgttgggg ttgattaatc tcgggagttc gagtgcgttt      1200
     acggcgtttg tttcggtggg ggttattgcg cttgctaccg cttatgctat tcctatcttt      1260
     ttgagtctgt ggtatggtcg gcgggaggtt gctaaggcgc cgtggaattg tgggggtgtt      1320
     gggtggtttg tgaatgttgt tgcgttggcg tggattgcgt ttgagttggt gctgtttagt      1380
     atgccaatgg ctttgccggt tacggcggtg tcgatgaatt atgcttcggt tgtttttgtc      1440
     gggtttatgg cgatttcggc ggtttggtat ggggtttatg cgaggaaata ttataagggt      1500
     ccgcctgagt cggatgctct cgattaa                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page