(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE222

PENCW_13.PE222       Location/Qualifiers
FT   CDS_pept        complement(513516..515699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946635"
FT                   /orf_name="Pc16g02220"
FT                   /product="Pc16g02220 protein"
FT                   /protein_id="CAP92892.1"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="UniParc:UPI0001831892"
FT                   /db_xref="UniProtKB/TrEMBL:B6H793"
FT                   /transl_table=1
FT                   /translation="MGNPALDLKVAQTNQSMVAIAGIPQNGETGQYIARGSNDRFELIS
FT                   GPLLNLKNMHYEATTTWHGSVLIVTKPTQDNPQLRLRQVGAVDSGAQNGEGRAPTSQTI
FT                   EGLKLYEDPQKAFWRFSLTVPVAAFEARWAYDIPGLYESGAQVQTSWEFVVPAEEQSMR
FT                   IMFHSCNGFSVGTDMDAWVGPNLWNDVMRVHGEKPFHVMVGGGDQIYNDGIRVDGPLKP
FT                   WTMISNPHKRRHHDFNNQMRAESDDYYYANYVRWYNTEPFRAANGRIPQVNIWDDHDII
FT                   DGFGSYTDHFMKCAVFRGIGGVAFKYYCLFQHHIAPPKSTFTTDSPQTMHAVNGTSGVD
FT                   PRQVENTYVLENQVEDDSWIIGKRPGPYVEERSRNLYMRFGKRIAFMGLDARTERTRHQ
FT                   VNYEDTYDLIFDRLQREIVDSNGDIKHLVVLLGVPIAYPRLAWLENILTSPLIAPVRLL
FT                   NKRFGVAGGLFNEFDGQVDLLDDLDDHYTARQHKRERKMLVHRLQEFARSHSVRVTILS
FT                   GDVHLAAIGRFYSNPKLNLSGENDHRFIVNVVSSAITNKPPPQAVANLLARRNKIHHLD
FT                   RECDETLMPIFDKQPGGREKGADWNKVTMPSRNFAILTEVVAPGAGNTGILDANSVKLD
FT                   RLPKDGHAPLHKGEVDAGTTHGAADGFTCATGMYGGLDVSVRVEIDPHDRSATTEGYGF
FT                   SIPPLLATEGPPSTGHRLSLHSRRSQGRPSTAM"
     atgggaaacc cagccctgga tctgaaagtc gcccaaacta accaaagcat ggttgcaatt        60
     gcagggatac ctcaaaatgg agagacgggc cagtacattg cgcgcggctc gaatgatcgc       120
     tttgagctca tctccggtcc cctgctcaac cttaagaaca tgcactacga agccacgacc       180
     acatggcacg gcagtgtctt gattgtcaca aagccaaccc aggacaaccc ccagctgcgc       240
     ctgcgccagg taggcgccgt ggacagcgga gcccagaatg gcgagggcag ggccccgacg       300
     agccaaacaa tcgaaggtct caagctctac gaagatcccc agaaggcatt ctggcgattc       360
     tcgctcaccg tgcctgtggc cgcattcgag gcgcgctggg cgtacgacat ccccggtctg       420
     tacgagtccg gggcccaggt ccagacatcg tgggaatttg tcgttcctgc cgaagagcag       480
     tccatgcgca tcatgttcca ctcgtgcaat ggcttttccg tcggcacgga catggatgcc       540
     tgggtggggc cgaacctgtg gaatgatgtg atgcgcgtgc atggcgagaa gccattccac       600
     gttatggttg gcggcggtga ccagatctac aacgatggta ttcgtgtgga tggtccgctc       660
     aagccttgga ctatgatttc gaacccacac aaaagacgac accatgactt caataaccag       720
     atgcgtgctg agagcgatga ctactactat gccaactatg tccgctggta caacaccgag       780
     ccattccgcg ctgccaatgg tcgcatcccc caggtcaata tctgggatga tcatgatatc       840
     attgatgggt tcggctcgta caccgaccac ttcatgaagt gtgctgtctt ccgcggtatc       900
     ggcggagtcg ctttcaagta ttactgtctc ttccagcacc acatcgctcc tcccaagtcg       960
     actttcacca ccgattctcc gcagactatg cacgctgtca atggaacttc tggtgtcgac      1020
     ccacgtcaag tggagaacac gtacgttctg gagaaccagg tcgaggacga cagctggatc      1080
     atcggcaaac ggcccggtcc ttacgtggaa gagcgcagcc gaaatctcta catgcgcttc      1140
     ggcaagcgca ttgcctttat gggtctggat gcgcgcacag agcgcacccg ccaccaggtt      1200
     aactacgaag acacctacga tctgatcttc gaccgactgc agcgcgagat cgtcgactcc      1260
     aacggcgaca tcaagcactt ggtggtattg ctaggtgtgc caatcgcgta cccacgtctc      1320
     gcatggctcg agaacatcct cacgtctccc ctgatcgcgc cggtccggct gctgaacaag      1380
     cgcttcggcg tggccggcgg cctcttcaac gagttcgacg gccaggtcga tctcctcgac      1440
     gacctggacg accactacac cgcgcgccag cacaagcgcg agcgcaaaat gctagtccac      1500
     cgcctacagg agttcgcccg cagccacagc gtgcgcgtca ccattctcag cggcgacgtc      1560
     cacctcgccg ccatcgggcg cttctactcg aacccgaaac tcaacctctc aggcgaaaac      1620
     gaccaccgtt tcatcgtcaa cgtcgtcagc agcgctatca caaataagcc gccaccccag      1680
     gccgttgcga acctccttgc ccgcagaaac aaaatccacc acctcgaccg cgaatgcgac      1740
     gagaccctca tgcccatctt cgacaaacag cccggcggtc gggagaaagg tgctgactgg      1800
     aataaggtca ccatgccatc ccgcaacttt gccatcctca cggaggtcgt cgccccaggt      1860
     gccggtaaca ccggcatcct cgatgccaat tccgtgaaac tggatcgtct tcctaaggac      1920
     ggtcacgcac cactgcataa gggcgaagtt gatgctggaa cgacgcacgg cgctgctgac      1980
     gggttcacct gtgcgaccgg catgtatggc gggcttgatg tttccgtccg tgtcgagatc      2040
     gatccccatg atcgtagcgc tactaccgag ggatatgggt ttagtatccc gcccctgttg      2100
     gctaccgagg gtcccccatc caccggtcac cggcttagtt tgcactcgcg caggtcccag      2160
     ggccgaccgt cgacggcgat gtaa                                             2184
//

If you have problems or comments...

PBIL Back to PBIL home page