(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE223

PENCW_13.PE223       Location/Qualifiers
FT   CDS_pept        join(complement(516550..517542),complement(516401..516419),
FT                   complement(516291..516316),complement(515918..516247))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824079"
FT                   /orf_name="Pc16g02230"
FT                   /product="Pc16g02230 protein"
FT                   /protein_id="CAP92893.1"
FT                   /db_xref="UniParc:UPI0001831893"
FT                   /db_xref="UniProtKB/TrEMBL:B6H794"
FT                   /transl_table=1
FT                   /translation="MQSPRLSPSADDMIPVNPLKRVKPTKSTNPNPPKDPQPVTKELSF
FT                   ASYLNRYMRHPWGVIDYHIYLTHIESGRDKLRREKECHLLETTGFAQVTLHDEPVLNNI
FT                   PAYTNPTVFFVSLPVPDIQNESSNALLVLGFDLQSDRLQGYFFEPESPVENYDDLWEVW
FT                   SQGEGHLVIDVPVDRFLAIIRHTMQHRIEILEIGVLHHYGLTTREFQAGLDMVVTVQFL
FT                   QFVDDFAELLSEEPDELRETYTPFQDELRELLASGSRDAWFAVRDGLNIEQYRQKQLKK
FT                   VVSSGLFQGQDVLVLRDGSEEITEKDKSRPVKIVPGHRRWSWSKLRVRVLLFRSIEIKS
FT                   PGVHDSGLYMYKCPKQDNSSIQIAIKICEIHENPRKSDRQKKKCTASLAQSGIARNHSC
FT                   GVTWLNWGVAGITFSPIGQTINGMSWQRQSCSSSFLGPRPQGPKGTDPQPPISLRV"
     atgcagagcc cccgtctctc tccgtctgcc gacgatatga tccccgttaa tccccttaaa        60
     cgggtcaaac ctactaagtc tactaaccct aaccctccca aggatcccca accggtaacc       120
     aaggaattgt ccttcgcatc gtatctgaac cgctacatgc gccatccctg gggcgtgatc       180
     gactaccaca tctacctcac acacatcgaa agcggccgcg acaagctccg tcgcgagaaa       240
     gagtgccact tactagaaac caccggcttc gcacaggtta ccctacacga cgagccagtc       300
     ctcaacaaca tccccgccta cacaaaccca acggttttct tcgtcagcct ccccgtcccc       360
     gacatacaga acgaatctag caacgccctg ttggtgctcg gcttcgacct acagtccgac       420
     cgcttgcagg gttatttctt cgagcctgaa tccccggtcg agaactatga cgacctctgg       480
     gaggtctgga gccagggtga gggccatctc gttattgacg tccccgtcga ccgtttccta       540
     gcaattattc gccatactat gcagcatcgg attgagatcc tggagatcgg cgtcctgcac       600
     cactacggcc tgactacccg tgaattccaa gctggcttgg acatggttgt tactgtgcag       660
     ttcttgcagt ttgtggatga ctttgctgag ctcctgtctg aggagcctga tgagcttcgt       720
     gagacttata cgcctttcca ggatgagctc cgtgaattac ttgcgagtgg atcccgggac       780
     gcttggtttg ctgttcgtga tggactgaat atcgagcagt atcgccagaa gcagttgaag       840
     aaggtcgttt cttctggttt gttccaggga caggatgtgc tcgtgttgcg agacgggtct       900
     gaggagatta ctgaaaagga taagtctcgt cccgttaaga ttgtgccagg tcatcgtcgg       960
     tggtcatggt ccaagctacg agtccgggtt ttgttgttcc gtagtataga aataaaaagc      1020
     ccaggtgtgc atgattcggg gctgtatatg tataagtgcc caaaacaaga caattcttct      1080
     atacaaatcg ctataaaaat ctgtgaaatc cacgaaaatc cacgaaaatc cgatcgacaa      1140
     aaaaagaaat gcaccgcctc tctggcccaa tcaggaatag ccagaaacca ctcatgtggc      1200
     gttacgtggc tcaactgggg cgtggctggc attaccttct ctcctattgg ccagaccatt      1260
     aacggaatgt cttggcagcg tcagagctgt tcgagctcct ttcttggccc aaggccccaa      1320
     ggccccaaag gtacagatcc gcagccccca atctcgcttc gtgtctga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page