(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE224

PENCW_13.PE224       Location/Qualifiers
FT   CDS_pept        518856..519248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946636"
FT                   /orf_name="Pc16g02240"
FT                   /product="Putative uncharacterized protein Pc16g02240 "
FT                   /protein_id="CAP92894.1"
FT                   /db_xref="UniParc:UPI0001831894"
FT                   /db_xref="UniProtKB/TrEMBL:B6H795"
FT                   /transl_table=1
FT                   /translation="MGQDSVFIVQAEYFQDFDGDAWVSVDSHDFDDPDNEEADWVTVVL
FT                   PEEMAHTHDDEDIMMYVLHNIQTRRAVVREVALHNMGTVCISIPIPVGTADTTSILVQA
FT                   ETDVKKWLEHIRDGMVTLDREVIFGR"
     atgggacagg acagtgtatt catcgtgcaa gctgagtatt ttcaggattt tgacggcgac        60
     gcctgggtca gcgtagattc tcacgatttc gacgatccgg acaacgagga agctgattgg       120
     gtcactgtag ttcttcctga agaaatggcc catacccatg atgacgagga cattatgatg       180
     tatgtgcttc ataacatcca aaccaggcga gctgtcgtga gggaagtggc actgcataac       240
     atggggacgg tctgtatttc gatcccgatt ccggttggta ccgctgacac gacttcgatc       300
     ttggttcagg ccgagaccga tgtgaagaag tggctcgaac atattcgcga cgggatggtt       360
     actcttgacc gggaggtgat ctttggtcgg taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page