(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE225

PENCW_13.PE225       Location/Qualifiers
FT   CDS_pept        join(complement(519962..520459),complement(519567..519621),
FT                   complement(519452..519530),complement(519294..519384))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946637"
FT                   /orf_name="Pc16g02250"
FT                   /product="Putative uncharacterized protein Pc16g02250 "
FT                   /protein_id="CAP92895.1"
FT                   /db_xref="UniParc:UPI0001831895"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A8"
FT                   /transl_table=1
FT                   /translation="MNKGKMPIYQGHSSSLSSEPPQLCSNPLTNLPSQFQPSVYKFTSG
FT                   QYFAEPAGHRSDYYWVTVYFPKDIDHRDIQDSEVMLYVKDMIVKGRFTIDDQSMHGLGG
FT                   KCLSIPIKRDPDTPLPKSYTPDPTHPDLLLAENLAAYWKDQIAFKKVTLDRRMIFVETR
FT                   RKTRVPAILGGIVTVFLSIFFDTWMDIWPYTYMNIYVHVLDTRELAMRFDIPTLTQFSD
FT                   STRQPIAQSLDNPFVLEI"
     atgaataagg gaaaaatgcc catttaccaa ggacacagtt cttcactaag cagtgagccc        60
     ccccagctct gttcaaaccc gctaaccaat ctgcccagcc agttccagcc aagcgtgtac       120
     aagttcacga gcggccaata cttcgccgag cctgccggcc atcgaagcga ctactactgg       180
     gtcaccgtgt acttcccgaa agacatcgac catcgtgaca ttcaagattc cgaagttatg       240
     ctttacgtaa aggatatgat tgttaaggga cgcttcacta tagacgatca gtcaatgcat       300
     ggtttagggg gaaagtgcct ctcgatcccc atcaagcgcg atccagatac ccctctaccg       360
     aagtcatata cgcctgatcc tacacatcct gatcttctcc ttgctgaaaa cctggcggcg       420
     tattggaagg atcagattgc gttcaagaag gttactctag atcgacggat gattttcgtg       480
     gagactcgtc gtaagacgcg tgtcccggcg atattgggtg gaatcgtcac agtcttccta       540
     agcatcttct ttgatacttg gatggacata tggccgtata catatatgaa tatatatgtt       600
     catgtacttg atactcgaga gctggccatg agattcgata ttcctacatt aacacaattc       660
     tcagattcta ccagacaacc cattgctcag tcacttgaca acccctttgt attggaaata       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page