(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE226

PENCW_13.PE226       Location/Qualifiers
FT   CDS_pept        join(521064..521205,521248..521552)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977311"
FT                   /orf_name="Pc16g02260"
FT                   /product="Putative uncharacterized protein Pc16g02260 "
FT                   /protein_id="CAP92896.1"
FT                   /db_xref="UniParc:UPI0001831896"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A9"
FT                   /transl_table=1
FT                   /translation="MPFFQASVFQSTQPDHDRRFHFKDPHNSQPGWVWGTVALPDTIGV
FT                   ATAGLVSWGDRATHGLGNYCISFPIKVETPEQNLERLTDQVQDAAMWWLRLVRDKSVSI
FT                   DKHMLFQARQPPPDRDDQLLDAPLHWERPKYTVPNPWSAVTVLQ"
     atgccttttt tccaagcgag tgtgttccag tcgacccagc ccgaccatga ccgacgattc        60
     catttcaagg acccccacaa cagccagcca ggttgggtct ggggtactgt ggctctccca       120
     gataccattg gtgtcgcaac agcgggcctg gtcagttggg gagatagagc gacgcacggg       180
     ttggggaatt actgtatctc attcccaatc aaggtagaaa cacctgagca aaacttagag       240
     agattgacgg accaggttca agacgctgca atgtggtggc tgagactcgt ccgagacaag       300
     tctgtttcta ttgacaagca catgcttttc caggctcgtc agccaccgcc ggatcgtgac       360
     gatcagttgt tggatgcgcc tttgcattgg gaaaggccta agtacacggt tccaaacccg       420
     tggtctgccg ttactgtgct gcagtag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page