(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE227

PENCW_13.PE227       Location/Qualifiers
FT   CDS_pept        join(complement(522919..523762),complement(522760..522863),
FT                   complement(522369..522702),complement(522128..522302),
FT                   complement(521795..522065))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946638"
FT                   /orf_name="Pc16g02270"
FT                   /product="Pc16g02270 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92897.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000183195D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B0"
FT                   /transl_table=1
FT                   /translation="MSNVVWAVWRAPCPGLRTSVLPVPFRAASRDLRITPWRMYSTSRQ
FT                   SMLPIPNLLSQLLARPSRPTPTPISPQRFNPVSTPRRFKRTSAASQKPKPKSDPSEVHP
FT                   RQKPFSDAEIKAIFGPAKFNAKLGNRILAVLHGHRLSGTLDADLPVDIARAVTKQQVDA
FT                   ALEWLRDEYPLDEDAAIFARIEREDRAAEEKLVRRAEKLGLYKPQSGSYDAELGEEGSP
FT                   YGKSVLKEARERNEKRLLAEQERKRQEWLDGEKEEQERLKREFGKNTSLQEYQEAALTE
FT                   ARPRADPIERPYLAWVQKHHIAATNDSPESMNITNSQRLLAPLLFSIVVLALCYTFAQK
FT                   YEFPARKDRIMPDVPPAVATVGAIVAANVAVTLLWKYIPPAWKLLNRYFVIVPFYPSSL
FT                   GMIGSTFSHQTWRHLGTNMMVLGLMGTRVHDEIGRGNFLAIYFASGVMGSVFSLTRSVI
FT                   LGRLGMTSLGASAATSGIVAAWCMSHFNDKLTMWILPQGLQDQIWTYGWVFLTCLVGTE
FT                   VFSLIAPAFLFRAWPLSRLTKMDHAAHLGGYATGAGCGYTLMQKRKERERKARQSRWF"
     atgagcaatg tggtctgggc cgtatggcgg gccccatgcc cagggctccg cacctctgtg        60
     ctgccagtac cattccgggc tgccagtcgc gatctccgca ttaccccatg gcgcatgtac       120
     agcacatcgc gccaatcaat gttgccaatc ccgaaccttt tatcccagct attagctcgg       180
     ccgtctcgac caactcctac cccgatatcc ccacaacgat tcaaccctgt ctctaccccc       240
     cgccgcttca aacgtacttc cgccgcatcc caaaaaccga agcctaaatc ggacccctcg       300
     gaggtgcacc ctcgccaaaa gcccttctct gatgccgaga tcaaagccat ctttggccct       360
     gccaagttca acgcaaagct gggaaaccgt atcctggccg tcctgcacgg ccaccgtctg       420
     agcggcacgc tcgatgcgga cttgccagtt gacattgccc gcgcggtcac caagcagcag       480
     gttgatgctg ccttggaatg gctccgagat gagtaccccc tcgatgagga tgctgctatc       540
     tttgcccgca ttgaacgtga ggatcgcgcg gcggaagaga agctcgtgcg ccgtgctgag       600
     aagctaggct tgtataagcc gcaaagcggt tcttatgacg ccgagctcgg cgaagagggc       660
     tctccttacg gcaaaagtgt tttgaaagag gctcgcgaga ggaatgagaa acgcttgttg       720
     gctgaacagg aacggaaaag gcaggaatgg ctcgatggcg agaaagaaga gcaagaacgg       780
     ctgaagcgcg agtttgggaa gaatacttcc ctgcaggagt accaggaggc tgcgctcact       840
     gaggctcgtc cccgtgcgga tcctatcgaa aggccgtatc ttgcttgggt tcagaagcat       900
     catattgccg ctactaacga tagtcctgag tctatgaata tcaccaattc tcagcgtctg       960
     ctcgctccgc ttctgttctc gattgtggtt cttgcccttt gctatacgtt tgcccagaaa      1020
     tatgagttcc cagcacgaaa ggaccgcata atgcccgatg tgcctcctgc cgtggctacc      1080
     gtgggcgcca ttgtggcagc taatgtcgca gtcacactgc tatggaaata catacctcct      1140
     gcatggaagt tgctcaaccg ctacttcgtg attgttccct tctatcccag ctcgctgggt      1200
     atgattggaa gcacattcag tcaccagaca tggagacacc ttggaactaa tatgatggtc      1260
     ctgggactta tgggaactag agttcacgat gaaatcggcc gcggaaactt tttggccatt      1320
     tacttcgctt ccggtgttat gggatctgtc ttctcattga cacgcagtgt catcctcggc      1380
     cgcctgggca tgacctccct tggagccagt gccgcaacca gcggtatcgt cgctgcatgg      1440
     tgcatgtctc atttcaatga caagctcacc atgtggattc tcccccaggg actccaagac      1500
     cagatctgga cctacggctg ggtcttcctt acctgcttag tcggcaccga agtcttcagc      1560
     ttgatagctc ccgctttctt attccgcgct tggcccctct cccggttgac caagatggac      1620
     cacgctgccc atctaggtgg ttatgcgact ggtgccggat gtggatatac cctcatgcag      1680
     aaaaggaaag agcgtgagag aaaggcgaga cagtcaaggt ggttctaa                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page