(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE228

PENCW_13.PE228       Location/Qualifiers
FT   CDS_pept        524168..524629
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946639"
FT                   /orf_name="Pc16g02280"
FT                   /product="Pc16g02280 protein"
FT                   /protein_id="CAP92898.1"
FT                   /db_xref="UniParc:UPI000183195E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B1"
FT                   /transl_table=1
FT                   /translation="MSTESLPITPGAFAEAIKELPIAVLYSKVSELTNSIAHLHRSNAE
FT                   LRAFLAESNDSEEDKKELEGYITENEGVAVSMNERILLLKTEVENRGQPWIELDELKIN
FT                   NDQEASPVTNGNETETETETETGVRPGSGAEAGAGQESHDREDGDGVYL"
     atgtcaactg aatctctccc aataacccca ggagcctttg ctgaggcaat caaagagctg        60
     cccatcgcag tcctctacag caaagtctcc gagctcacaa actccatcgc acacctgcac       120
     cgctcgaatg ccgagctccg cgcattctta gcagaaagta acgactcaga agaagacaag       180
     aaggagctgg aggggtatat cactgagaac gagggtgtgg cagtgtccat gaatgagcgg       240
     atcttgttgc tgaagaccga ggtcgagaat cgtggacagc cttggattga gcttgatgag       300
     cttaagatca acaatgacca ggaagcttcg cctgtgacga atggaaatga gactgagact       360
     gagactgaga ccgagaccgg tgttaggcct gggtctgggg ctgaggcggg tgcaggacag       420
     gagtctcatg atcgggagga cggggatggg gtctatctgt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page