(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE229

PENCW_13.PE229       Location/Qualifiers
FT   CDS_pept        join(complement(526548..526570),complement(526018..526286),
FT                   complement(525846..525960),complement(525278..525794))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128413"
FT                   /orf_name="Pc16g02290"
FT                   /product="Pc16g02290 protein"
FT                   /protein_id="CAP92899.1"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="UniParc:UPI000183195F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B2"
FT                   /transl_table=1
FT                   /translation="MATFFQSVRQGFGRGGNNKSNNPPKSPAQTSAPQHQATMSNSPSI
FT                   SSSLSVENQANDPEGPKYFFQEKYAPLNVRGNFLTLCACPKNVELGEWLAHQIVEQYRL
FT                   LHGMLQVIQEVNTVTGLPICNENTCPTMSAGRLTYTWLVDGRAAKISAPKFINRVEKWI
FT                   VSKIHDPVMFPTEKVNGTPETSAIKEANGASATPSDPANPDEWIGKSSGFPPTFYKDCQ
FT                   GIMKQMFRCYAHLYHAHWLNPFWHINKHDVLNMCFVHFVTVSKYYGLVSDKEMEPMQPL
FT                   IELFIKQQRVPPEALNGGHWAQQATT"
     atggcgacct tcttccagag tgttcgccaa ggatttggcc ggggaggaaa caacaaaagc        60
     aacaatcccc ccaagagccc agcacagacc tctgctcccc agcatcaagc taccatgtcg       120
     aattcgccct ctatttccag cagtctgtca gtagagaacc aagcgaacga tcctgagggg       180
     cccaaatact tcttccagga gaagtatgcc ccgctgaatg tgaggggcaa cttcttgacc       240
     ctctgtgctt gcccgaagaa tgtggagctg ggcgagtggc tggctcacca gattgtggaa       300
     caatatcgtc tactccacgg catgctccag gtcatccaag aggtgaacac tgtgacgggt       360
     ctacccattt gcaacgaaaa cacttgtcca acaatgtccg ctggacggct gacctatacc       420
     tggcttgttg acggccgcgc cgctaaaatc tccgccccaa agttcatcaa ccgcgtcgag       480
     aaatggatcg tcagcaagat ccacgacccc gttatgttcc ctaccgaaaa agtaaacggc       540
     actcccgaga catctgccat caaagaggcc aatggcgcat cagcaactcc ttccgacccc       600
     gccaacccag atgagtggat cggcaagtcc agtggcttcc cgccaacctt ttacaaggac       660
     tgccagggta tcatgaagca gatgttccgc tgctacgccc atctgtacca cgctcattgg       720
     ctcaacccct tttggcacat taacaagcac gatgtcctga acatgtgctt cgttcacttc       780
     gtgaccgtct ccaagtacta cgggcttgtg tctgataagg agatggagcc catgcagccc       840
     ttaattgagc tgttcatcaa gcaacagcgg gttcccccag aggcgctcaa cggtggtcac       900
     tgggcccagc aggccaccac ttaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page