(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE23

PENCW_13.PE23        Location/Qualifiers
FT   CDS_pept        join(54928..55051,55111..56228)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671087"
FT                   /orf_name="Pc16g00230"
FT                   /product="Putative uncharacterized protein Pc16g00230 "
FT                   /protein_id="CAP92693.1"
FT                   /db_xref="InterPro:IPR022190"
FT                   /db_xref="UniParc:UPI0001831DB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T1"
FT                   /transl_table=1
FT                   /translation="MQDPVPAAPSLRAPSAVPEDPSADIECIDLSGEDATNQDPGTSTG
FT                   LRFVDAKGNDVTNSMPAGVTQTGQLILDGVERTGQAAEMAEAIKANGGFLDWSTTADGA
FT                   FILRSVVSEKKQLAALGQTLGHNIPGVVCDGCADGSAFLTCRVAAFRDRQGVGHIVLKG
FT                   SCMNCQFKKQAPVCSIRTSQPPSALDLFRSYEPNFQWGPTSAGSAALSTSPAPPTSPTS
FT                   PTSPTSPAPSAPLGPSVRFTRQQPGRHGSQSSMSVAKRPRLPSPSLSGSGTPTLRQKSN
FT                   TGSTVHVTPRSPLAGGGPQPSTPAPIVKSNQTQREEACPQIHEILSQASPDGPHRYNSV
FT                   LSRELYEASLEARVTAECRLRRQIAQANIDVEHMNRDLDALVKDRLRMDGYVSQGADQD
FT                   PCWLGHGSSSAPGE"
     atgcaagatc ctgtccctgc agccccctct ctacgtgcac cctctgctgt acctgaggat        60
     ccttcggctg acatcgaatg tatcgattta tcgggtgagg acgcaaccaa tcaagatccc       120
     ggcacttcca ctggtctgag gttcgtcgat gcaaagggca acgatgtaac caacagcatg       180
     cctgccggag tcacccagac cgggcagttg atcctggacg gtgtcgaaag aacaggacaa       240
     gccgccgaaa tggccgaagc gataaaggca aacggtggct tcctcgactg gtcgacgacc       300
     gccgatggtg ccttcattct tcgaagcgtt gtcagcgaaa agaagcagct ggccgcgttg       360
     ggccaaaccc ttggtcacaa cattcctggt gttgtttgtg atggctgcgc tgacggcagt       420
     gccttcttga cgtgccgagt ggccgccttt cgcgatagac agggagtggg ccatattgta       480
     ctcaagggat cttgcatgaa ttgtcagttc aagaagcagg ctccagtctg ttccattcga       540
     accagccagc ctccctcggc actggaccta ttccggtctt atgagcccaa ttttcagtgg       600
     ggtcccacct ctgccggctc tgctgcccta tctacttctc ctgcccctcc tacatctcct       660
     acatctccta catctcctac ctctcccgcc ccttccgccc ctcttggccc ttctgtccgt       720
     tttacgagac agcaacctgg tcgtcacgga tcgcaatctt ctatgagcgt tgcaaagcgc       780
     ccacgtttac cttccccttc tctttcagga agcgggacgc ctactcttcg tcagaagtcg       840
     aatactggga gtacagtaca tgttactcct cgctcccccc tggctggggg tggtccgcaa       900
     ccatccaccc cagcgcctat cgtgaagtcc aaccagacgc agcgcgagga ggcgtgcccc       960
     caaattcacg agatattatc acaggcgtcg ccggatggcc cgcacaggta caactccgtt      1020
     ctcagtcgtg agttgtatga ggcaagtctg gaagccaggg ttactgctga atgtagactc      1080
     aggcgccaga ttgctcaggc aaacatcgac gtagagcaca tgaaccgtga tttggatgct      1140
     ctcgtaaaag accgactccg aatggatggt tatgtgtctc aaggtgctga tcaggatcct      1200
     tgctggttgg ggcacggctc ttcttctgct cctggggaat ag                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page