(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE230

PENCW_13.PE230       Location/Qualifiers
FT   CDS_pept        join(526920..527068,527120..527285,527339..528331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128414"
FT                   /orf_name="Pc16g02300"
FT                   /product="Pc16g02300 protein"
FT                   /protein_id="CAP92900.1"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniParc:UPI0001831960"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B3"
FT                   /transl_table=1
FT                   /translation="MSSDEEGVRRPSNGNESPAHSNAHDSGADQMDEGDDLFGSDGEGG
FT                   LDDIEPHRTLDDEQLDSGDDENRYDRREDRMEDVAEEQQEVNVADQDLARAPVPLTNDG
FT                   EVYTMRVPDFLSIEGEEFNPETYVPPPYQTAATSLCWRKDPADESLLQSNARIIKWEDG
FT                   SITLQLASAPLEQYRIASKPLAPLTKSGDYDHKLDSHVYLAAGLETAQVFRLTSHITQG
FT                   LTVLPTTLETDDAVQRLQEQLAAAARGSKQTAAGTAPRYELTEDPELAGKRAEMMEKEA
FT                   IKAERRRQQLADREADRGRRHGATRPGPSGLSVGGLEDAGLLTTRPRAKPRRQNRRGEI
FT                   YTDDEEEDYSRGARNREDEYDEDDGFLVGSDEEVEEEAEDEEEELEDEDMDAEGEDDVE
FT                   AAPAKAGRSKPEPQVRDGTPPARKKNRYVVDDEDDE"
     atgtcctccg atgaggaggg cgtccggcgc cccagcaatg gcaatgagag ccctgcgcac        60
     agcaatgccc atgattctgg cgcggatcaa atggatgaag gtgacgatct ctttgggtcg       120
     gatggtgaag gcggacttga tgacattgaa ccccaccgca ccttggacga tgaacaactc       180
     gactcaggtg acgatgagaa ccgatatgat cggcgcgaag accgaatgga agatgtagcc       240
     gaggagcagc aggaagtcaa tgttgctgac caggaccttg ctcgggcgcc agtgccattg       300
     accaacgatg gagaggtcta cacaatgcgt gtaccggact tcctctcaat cgaaggagaa       360
     gaattcaatc ccgagactta cgtcccaccg ccttaccaga ccgccgctac ctccctttgc       420
     tggcgcaaag accccgcgga tgagtctctt ttgcagtcta atgcccgcat tatcaaatgg       480
     gaggatggct ctattactct tcaactcgcc tctgcccccc ttgagcaata ccgcatcgca       540
     tctaaacccc tcgcacctct caccaagtcc ggcgactatg accacaagct cgactcccac       600
     gtttatctcg cagctggact ggaaacagcc caagttttcc gattaacctc acatatcacc       660
     caaggtctca ctgttctccc gactaccttg gagacggacg atgccgttca gcgactgcag       720
     gaacaattgg ctgctgctgc tcgtggtagc aagcagaccg cagctggcac tgcgccgcgc       780
     tacgaactaa cagaggatcc cgagttggct ggtaaacgtg ccgaaatgat ggaaaaggaa       840
     gctatcaagg ccgaacgtcg tcgccagcag cttgctgatc gcgaggccga ccgtggtcgc       900
     cgccacggcg ccactcgtcc cggtcctagc ggtcttagcg tcggtggtct tgaagatgcc       960
     ggtttgctca ccactcgtcc acgtgccaag cctcgccgcc aaaaccgtcg cggcgagatc      1020
     tacaccgacg acgaagaaga ggattactct cgtggtgccc gtaacagaga agatgagtac      1080
     gatgaggacg atggattctt ggttggcagt gacgaggagg ttgaggaaga agcggaagat      1140
     gaagaggagg agctcgaaga tgaagatatg gacgctgaag gtgaggatga tgtggaggct      1200
     gctcctgcga aagctggccg tagcaagcca gagcctcaag tcagggatgg tacacctcct      1260
     gcccgaaaga agaaccgcta cgtggtggac gacgaggacg acgagtga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page