(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE234

PENCW_13.PE234       Location/Qualifiers
FT   CDS_pept        join(535359..535402,535580..535943,536034..536261)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946641"
FT                   /orf_name="Pc16g02340"
FT                   /product="Pc16g02340 protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAP92904.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001831964"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B7"
FT                   /transl_table=1
FT                   /translation="MGNSSSSQKISAQDRAILDLKNQRDKLHQYQRRITVLTDRETEIA
FT                   KECLARDDRRRALLALRRKKYQESLLAKTDGQLAQLEQLTGQVEFALVQKDVLFGLQQG
FT                   TKVLQTINKEMGGIEGVERLMGETEDARAYQEEVSQMLAGHLTNQDEDEVEDELEALQR
FT                   ELAGPEILPDDVVLPSPPTADLPVEEPVLESSKRTKAKAETRTALPAT"
     atgggaaatt cgagtagctc gcagaagatc tctgcccagg atcgggcaat ccttgaccta        60
     aaaaaccaac gcgacaaact acaccaatat cagcgacgaa taaccgtcct cacagaccgc       120
     gaaacggaaa tcgccaagga atgtctcgcc cgcgatgatc gccggcgagc actgctcgcc       180
     ctccgacgca agaaatacca ggaatcactc cttgcgaaga cagatgggca gctcgcgcag       240
     ctggagcagt taactgggca ggtggagttc gcgcttgtgc agaaggacgt gctgtttggg       300
     ttgcagcagg ggacgaaggt gctgcagacg attaataagg agatgggtgg cattgagggt       360
     gttgagagat tgatggggga gaccgaggat gcgagggctt atcaggagga ggtgagtcag       420
     atgctggcgg gacatttgac gaaccaagat gaggatgagg tcgaggatga gctggaggct       480
     ctgcagcggg aacttgctgg ccctgaaatc ctgcctgatg atgtcgtatt gccgagtccg       540
     cctactgctg atctgcctgt cgaagagccg gtgctggagt catccaaaag gaccaaggca       600
     aaggcagaga ctcggacggc tttacctgct acttag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page