(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE235

PENCW_13.PE235       Location/Qualifiers
FT   CDS_pept        join(complement(537370..537499),complement(537202..537313),
FT                   complement(536626..537046))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128417"
FT                   /orf_name="Pc16g02350"
FT                   /product="Pc16g02350 protein"
FT                   /protein_id="CAP92905.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI0001831965"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B8"
FT                   /transl_table=1
FT                   /translation="MSGHHHDHGHCHGEDHDHTNDITPAIQSLLYSQINFDLITTLNET
FT                   TPNSGASIVQKTWAERLNDKPELESDADEQLLMTIPFNGQVNVHSLLLYTAPTNSAPRT
FT                   VKLFKNRDDLDFSTASELHPAQTIEVPRPVPGADVFELPLNRAHWNATTSVTLFFEDNW
FT                   SDGEEDVTKVGYVGFKGQFMKLTREPVNFLYEAAANPQDHVSIPGVSGIGGRIMPGQ"
     atgtcagggc atcatcatga tcatggccac tgccatggcg aagatcacga ccataccaac        60
     gacatcactc cggccatcca atccctcctc tactctcaga tcaacttcga cctgatcaca       120
     actctgaatg agacaacccc aaactctggc gcatccatcg tccagaaaac ctgggccgag       180
     cgactgaacg acaagcccga gctcgagagc gatgcagacg aacagctgct catgaccatc       240
     cccttcaacg gccaagtcaa cgtccactcc ctcctcctgt acacagcccc tacaaactcc       300
     gccccaagga cagtaaagct gtttaagaac cgcgacgatt tggatttctc aactgcatcg       360
     gagctgcacc cagctcaaac tatcgaggtc ccgcggcccg tacccggcgc cgatgtcttt       420
     gaactgccgt tgaatcgtgc ccattggaat gcgactacct ctgtcacact gttcttcgag       480
     gacaattgga gtgacggcga ggaggatgtt accaaggttg ggtatgtagg cttcaagggg       540
     cagtttatga agttaacccg ggagccggtt aatttcctct atgaggctgc ggcgaacccc       600
     caggatcatg tttctattcc tggtgttagc ggtattggtg gcaggattat gcctgggcaa       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page