(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE236

PENCW_13.PE236       Location/Qualifiers
FT   CDS_pept        join(complement(539808..540032),complement(538084..539742),
FT                   complement(537892..538026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671375"
FT                   /orf_name="Pc16g02360"
FT                   /product="Pc16g02360 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92906.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831966"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B9"
FT                   /transl_table=1
FT                   /translation="MASEQELSTSFIPALYKPAALLPIARHKKNLLYLVEKYPVTIVVG
FT                   QTGSGKTTQLPQYLDQAGWCEDGKIIAVTQPRRVAATTVATRVAEEMRCKVGEEVGYSI
FT                   RFEDLTSPATRIKFLTDGMLLREALVDPLLSRYSVIMVDEAHERSLGTDVLLGTLKKIR
FT                   KKRPELRIIVSSATLQAEDFLRFFAGEEYQPEAEPEDLGGSVGRIISLEGRMYPVDILF
FT                   LDSPAEDYIERAVKTVFDIHTQEPEGDVLLFLTGREEIDTAIQLISERAATLHPKAPSL
FT                   LPLPLYAGLTTEQQMYVFEPTPENTRKVIVSTNIAEASVTIDGIVYVIDSGFAKLRAYN
FT                   PNTGIDTLTAVPISKASATQRAGRAGRTKPGKCFRLYTQQAFEQMPEARVPEIQRSNLA
FT                   PVIMQLKALGIDNIVRFDFLTPPPAELIIRALELLSSLGAVDDYAKLTKPLGMRMAEIA
FT                   LDPMMAKVLLVAPSFNCLSEILTIAAMVNLQGTVWVQHAGDKRSAESHRRKFAVEEGDH
FT                   LTYLNVYQAFVTKGKKDSKWCRDNLLNYRALLRAVSIRGQLKRYLERFGIQVDETLSSR
FT                   HGAADLSKQPEQIRRCLTTGYFAHAAKMQPDGTFKTVSGGLTLHAHPTSLMFNRKADWV
FT                   IFHEIMQTGEKTYIRDVTKIEKSYLLEYAPDYYRVRQ"
     atggcttcag aacaggagct ctcgacctct ttcattccag ctctgtataa accagctgct        60
     ttactgccta tcgcacgtca caagaagaac ctgctctatc tggttgaaaa gtaccccgtc       120
     actatcgtgg tgggccaaac aggtagtggg aaaacaaccc agcttccgca gtacctagac       180
     caagcaggat ggtgcgagga tgggaagatc attgctgtta cacagccccg gcgggtggct       240
     gctacaacgg ttgccacgcg agtagccgaa gagatgcgat gcaaagtcgg cgaagaggtg       300
     ggctactcta tccgatttga agatttgaca tctcctgcca caaggatcaa attcttgaca       360
     gatggcatgc tgctcagaga agccctggtt gatcctctac tttcgcggta ttcagtgatc       420
     atggttgatg aggcacatga gagatctctc ggtaccgatg tgctccttgg gactctaaag       480
     aagatccgca agaagcgccc tgaacttcgc ataattgtta gtagcgcaac cctccaggca       540
     gaggatttcc ttcgtttctt tgccggcgag gagtaccagc ctgaggcaga gccggaagat       600
     ttgggtggaa gcgttggtcg gatcatcagc ctggaaggac gaatgtatcc agtcgacata       660
     ttgttccttg attctccggc agaagattac atagagcgag cagtcaagac cgtctttgat       720
     atccataccc aagaaccaga aggcgacgta cttctctttt tgactggccg ggaagagatc       780
     gacacagcga tccagttgat atctgaaaga gcggcaactc tccatccaaa ggcgccctct       840
     ctgcttccac taccactgta tgctggactc accacggaac agcaaatgta cgtcttcgag       900
     ccgaccccag aaaacacccg gaaggtcatc gtctcgacca acattgccga ggcctcggtc       960
     acaatcgacg ggattgtata tgtgatcgat tccggcttcg ccaagctcag ggcatacaat      1020
     cccaatactg ggattgatac attgactgca gtgccaatat caaaagcatc cgccacccag      1080
     cgagctggcc gcgctggaag aacgaagcca gggaaatgtt tccgtctgta cacgcaacaa      1140
     gcattcgagc agatgcccga agcaagggta cctgaaatcc agcggtcaaa tctcgcaccg      1200
     gtcattatgc aacttaaagc actgggaatc gacaatattg tccggttcga cttcttgaca      1260
     cccccgccgg cagagctcat cattcgtgca ctggagctcc tgtcgtctct cggtgcggtt      1320
     gacgactatg ccaaactgac gaagccgctt ggaatgcgga tggcagaaat cgctctggat      1380
     cctatgatgg ccaaagttct tctcgtcgcg ccatctttca actgtctaag tgaaatcctc      1440
     acaattgcgg ccatggtcaa cctccagggg acggtgtggg ttcagcatgc tggagacaaa      1500
     agatctgctg agagccaccg gcgaaagttc gccgttgaag agggtgatca tttgacgtac      1560
     ttgaacgtgt accaggcctt tgttaccaaa gggaagaaag actcaaaatg gtgtcgcgac      1620
     aacctcttga attaccgagc cttgcttcgc gcagtgagca tccgaggcca gttaaaacgg      1680
     tacctagaac gctttggcat tcaagtcgac gagacacttt catcccgtca tggcgcagcc      1740
     gatttgagca aacagccgga gcagattcgg cgatgtctta cgacaggcta ttttgctcac      1800
     gcggcgaaga tgcagccgga tggaactttt aagactgtca gcggtggtct gactcttcat      1860
     gctcacccta cttcgttgat gtttaaccga aaagccgatt gggtcatatt ccatgaaatc      1920
     atgcaaacgg gtgaaaagac ttatatccgc gatgtcacta agatcgagaa gagttatctg      1980
     ctggagtatg ctccggatta ttaccgagtg aggcaataa                             2019
//

If you have problems or comments...

PBIL Back to PBIL home page