(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE237

PENCW_13.PE237       Location/Qualifiers
FT   CDS_pept        join(540337..540357,540417..540726,540790..541032,
FT                   541087..541353,541406..541800)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671376"
FT                   /orf_name="Pc16g02370"
FT                   /product="Pc16g02370 protein"
FT                   /protein_id="CAP92907.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI0001831967"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C0"
FT                   /transl_table=1
FT                   /translation="MSEEDKMNTPGRPLGALNSPNSPRAESPTTARPMDFDDEPQETGV
FT                   ITSSPVAPQPAAAEPAPPKPPRPLSPREQSENTLREAFPSIEPGVVKAVLTASNWHVER
FT                   AFNALLGMTDPKAQEEMTPPPKPPRPTQQSTAAQRQLEADEMYARQLSEHYNATGRRAP
FT                   PPGWESDPRYQRPRGSEDSEEREYSFFDDDLPVIRENLRKGFLETQNKVNSWVTNLKKR
FT                   IDGDDLDEEPSQNQRETTHARPRRSGDMGRRSGDRERYDADPQVLSDDFSALELRDGEA
FT                   PPPRPPRPGNSSLKPSVSPSPDRRRVSFQEGPPTEIDNSYDASTPSKRLSSTGSKSSKW
FT                   QPLSTVEPSPVAENDPFSLGDSDDEKEIKTKEQTTSSEGDQLKHATVESVSDEVGSSKG
FT                   PDTKGASKPESK"
     atgtcagagg aggacaagat gaacactccc ggcagaccct tgggtgccct taattctcct        60
     aacagcccac gagccgagtc accgactacc gcgcgcccga tggactttga cgacgagccc       120
     caggagaccg gggttattac ttcctcccct gttgctcctc agccagctgc cgccgagcca       180
     gccccgccaa agccgccccg gcccctgagc ccgagagaac agtcggagaa cacccttagg       240
     gaggcatttc caagcatcga gcctggcgtc gtcaaagcgg tcttgaccgc aagcaattgg       300
     catgtcgagc gggcgttcaa tgccctcctt ggtatgactg accccaaggc tcaagaggaa       360
     atgacaccac cgccaaaacc gccgcgccca acccaacaga gcactgctgc gcagcgacaa       420
     ctggaagccg atgagatgta tgcacgtcaa ctatccgagc actacaatgc gacaggacgt       480
     cgtgcaccgc ccccgggctg ggagagcgac ccccgatacc agcgacctag aggaagcgaa       540
     gattcggaag agagggaata cagcttcttt gatgatgatc tacccgtgat ccgcgagaac       600
     ctccgcaagg gcttcctgga gacacagaat aaagttaatt catgggtaac aaacctgaag       660
     aagagaattg acggagatga tttggacgaa gaacctagcc agaaccaaag agagaccacc       720
     catgcccggc cccgacgtag tggtgatatg ggccgtcgca gtggagatcg tgagcgctat       780
     gacgcagatc ctcaagttct cagcgatgat ttctctgctc tggagttgag ggatggtgaa       840
     gctcccccgc ctcggccccc tcgccccggt aactccagcc ttaaaccctc cgtgtctcct       900
     tcgccagaca ggcgcagggt ctctttccag gagggaccac ccaccgagat tgacaactct       960
     tacgatgcct ccacgccatc caagcgtctc agctcaacag gcagcaagtc gagcaagtgg      1020
     caaccattgt ccacagttga gccttctccc gttgcggaga acgacccatt cagcctgggc      1080
     gatagcgacg atgagaagga gattaagact aaggagcaaa ccactagctc ggaaggcgat      1140
     cagctcaagc acgctactgt tgagtcagtg tccgatgaag ttggttcctc caagggcccg      1200
     gacaccaagg gcgcgagcaa gcccgagtcg aaataa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page