(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE239

PENCW_13.PE239       Location/Qualifiers
FT   CDS_pept        543254..544171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977312"
FT                   /orf_name="Pc16g02390"
FT                   /product="Pc16g02390 protein"
FT                   /protein_id="CAP92909.1"
FT                   /db_xref="UniParc:UPI0001831969"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C2"
FT                   /transl_table=1
FT                   /translation="MSYEITTHSGGARCFLIPPKKPSAWQQFRDEPCLFLARKLSAWRP
FT                   TNLPKLPENPVTVVCISNTYHERPEIPPGDILIHAGDLTSDGSLAELQITLNWLQAQPH
FT                   PIKIAVAGRADRYLDKMKKGGRRWRHGHRERAYWGDIIYLEHQHLTVTAPNGRQLRIYG
FT                   SPYSPMTVPSLAFQYSDSDNIWDRVPDNMDILITHTPPYTHRDSLRGCLHLLNHIWMDP
FT                   PRLHVFGCAREHHGCEFLYYDALQAAVERIEDVGGGFSNLLMVVKGLVQSFFRPDIKAK
FT                   SVLVNACTNGGLWDPERQPISVVI"
     atgtcttacg aaataactac acacagcggt ggtgcaagat gctttctcat accaccgaaa        60
     aagccatcag cctggcaaca attccgtgat gaaccttgtc tcttcctcgc ccgcaagctc       120
     tctgcctggc gaccaaccaa cctccccaaa ctgcctgaga accctgtcac cgttgtctgc       180
     atctcaaaca cctaccatga gcgaccagag ataccgcccg gcgacatcct gatccatgcc       240
     ggcgatctga catcagatgg atcgcttgcc gagctacaaa tcacgttgaa ctggctgcaa       300
     gcccagcctc atcccattaa gattgctgtg gcgggtagag ctgaccggta tcttgataaa       360
     atgaagaagg gaggtcgtcg ctggagacat ggacatcgcg agagggcata ctggggcgac       420
     atcatctatc tggaacacca gcatctcacc gtgactgctc cgaacggacg ccaactccgg       480
     atctatggaa gtccgtattc accgatgact gtcccttcct tggcttttca gtactctgac       540
     tccgacaata tttgggaccg agtccctgac aacatggaca ttctcatcac ccacacaccg       600
     ccatacacgc atcgcgactc tctccgaggc tgcctgcatt tgttgaatca catctggatg       660
     gatcctcctc gactgcatgt cttcgggtgc gctcgtgagc atcatggatg tgaatttctg       720
     tactatgatg ctcttcaggc ggctgtggaa cgcattgagg atgtaggtgg gggcttctcc       780
     aatcttctca tggtagttaa agggcttgta cagtccttct tccgacctga tatcaaggcc       840
     aagtctgtgc ttgtaaatgc atgcactaac ggggggttgt gggatcctga acgccaaccg       900
     atctctgttg tcatctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page