(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE24

PENCW_13.PE24        Location/Qualifiers
FT   CDS_pept        56975..58183
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128154"
FT                   /orf_name="Pc16g00240"
FT                   /product="Pc16g00240 protein"
FT                   /protein_id="CAP92694.1"
FT                   /db_xref="UniParc:UPI0001831DB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T2"
FT                   /transl_table=1
FT                   /translation="MALVTAKEANEAQYPTTPRASMDEALMPGLVSKSLDRQCRKGFCD
FT                   FVDAVFPNIYYTYSTRVELPWFEIAQYDRGAGIAMQWAFRSLGTLQIGRVNGDQRQILA
FT                   SQEMYGRGLRYLVQAVKNPATVGTEDTLGAAILLGIYEAMNETGQNSWLLHSRGISHLL
FT                   RLRGAKSHASGYGRTLLLSFRGLLVYEAFTRGEACFLESEEWRSTLPETLEDEERRGTS
FT                   CGLGQLMDYAFNEIAQCPGFLAKTKSLVASSRTTDAEREDLISAINSSREVLSDVEIQI
FT                   MAGVKADHEGNKKESQAFFGLIPPSIKDASVKFTLEGVHSGIALLRQLSVVLMSDRNRQ
FT                   KAVTPWLKVDPCKNEWKLIKNAGEIAQAQKDNRLHPTGPQQQGSATIWHDRIALAMGMP
FT                   EMV"
     atggcgctgg tcactgccaa ggaagccaat gaagcgcaat accccacgac accccgcgca        60
     tctatggatg aggctctaat gccaggattg gtttccaagt cactggaccg acaatgcagg       120
     aagggatttt gtgatttcgt ggatgcggta tttccgaaca tttattacac ttacagcacc       180
     cgggtggaac ttccttggtt cgagatcgct cagtacgacc gaggcgcagg gattgcaatg       240
     caatgggcgt ttcgcagcct ggggaccctg cagataggca gagtaaatgg tgatcaacgg       300
     cagattcttg ccagccagga aatgtacggc cgtggactgc gttatctagt tcaggctgta       360
     aagaaccctg ctactgttgg cacggaagac accctcggag ccgcaatcct gctaggaatt       420
     tatgaagcga tgaatgagac tggacagaac tcatggctgc tgcattcacg cggaatctca       480
     catctactgc gtcttagggg ggcgaagagt catgcgagtg ggtatggccg taccctgctg       540
     ttatcctttc gaggactttt agtttacgag gccttcactc gcggggaggc atgtttcctg       600
     gaaagcgagg agtggaggtc aactcttcca gagaccctgg aagacgagga acggcgcggc       660
     acaagctgtg gcctgggtca gctcatggac tatgcattca acgagatagc tcagtgccct       720
     gggttccttg ccaagactaa atccctagtg gcctcctcgc gaaccacaga tgcggagaga       780
     gaggatttaa taagtgcaat caacagcagc cgagaggtcc tgagcgacgt ggaaatccaa       840
     ataatggctg gggttaaagc tgatcatgaa ggaaataaga aagagtctca ggctttcttt       900
     ggattgattc ccccttccat caaagacgca tcggtgaaat tcacacttga aggggttcat       960
     tcagggatcg cacttctccg gcagttgtca gttgtgctaa tgtccgatcg gaatcgacaa      1020
     aaagcagtaa caccgtggtt aaaagtcgat ccttgtaaga atgagtggaa gctcattaag      1080
     aacgctggag aaattgccca ggcccaaaaa gataatcgac tgcacccaac aggtccacaa      1140
     caacagggca gcgcgacgat ctggcatgac cggatcgcct tagcaatggg gatgccagaa      1200
     atggtttga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page