(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE240

PENCW_13.PE240       Location/Qualifiers
FT   CDS_pept        544665..545183
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671378"
FT                   /orf_name="Pc16g02400"
FT                   /product="Pc16g02400 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP92910.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000183196A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H733"
FT                   /transl_table=1
FT                   /translation="MAPQYETGGMGGMPGLTISDIHALKRNEALEILARISRVEKKTFP
FT                   TNEAFPFGEDLWRKKPNTRVLYAIRAKGSQSDLIAYAVYVRQKGIALLHKVCVTEPNRR
FT                   RGVGQEVLSYIQQRLRKEGCQYIQLWVDQAREPARALYLRIGFEEREVIPDYYAPGRTG
FT                   IKMVLDLQA"
     atggcacctc aatacgaaac gggaggaatg ggaggaatgc ccggcctcac catctcggac        60
     attcatgcct tgaagaggaa cgaggcactg gagattcttg cccggatttc acgcgtcgag       120
     aaaaagacct tccccactaa tgaggcattc ccattcggcg aggacttgtg gcgaaaaaag       180
     cctaacacgc gagttctgta cgcgattcga gccaagggat cgcaatctga tctgattgcc       240
     tacgcggtct atgtccgaca gaagggcatt gcacttttgc acaaggtctg tgtaacagag       300
     cctaaccgcc gtcgaggtgt tggccaggag gtgctgtcct acattcagca gcgcctgcga       360
     aaggagggct gccagtatat tcaactctgg gtagaccagg ccagggagcc tgcacgcgcc       420
     ttgtatctcc gcataggatt cgaggaacgt gaagtcatcc ctgattacta cgcccctgga       480
     cgaacaggaa tcaaaatggt cctagattta caagcttga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page