(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE241

PENCW_13.PE241       Location/Qualifiers
FT   CDS_pept        545709..548537
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977313"
FT                   /orf_name="Pc16g02410"
FT                   /product="Pc16g02410 protein"
FT                   /function="calcium ion binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92911.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniParc:UPI000183196B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H734"
FT                   /transl_table=1
FT                   /translation="MAFFLTIVLVFLSVASAASLSANYPINAQLPPVARVSQPFRFEFA
FT                   QSTFANTDADTKYSLLNAPSWLEVDSSSLALYGTPDSSDSGANEFKLVASNGSEKDSMD
FT                   VTLIVTADQGPTVNKPLVPQLQKSGPVSYPATLFIHPGRQFSIEFDQDTFDNTHPSTIY
FT                   YGTSPNNAPLPPWITFDPAALKFAGNSPAFPGAGPQTFTFQLVASDVAGYSAANVTFEL
FT                   SIGPHILTFNETVQNFNLTRGEEFNSPKFTSLLSMDGSPVSIKELEKVDAELPNWLNLD
FT                   KENISLSGTPPKDAVNQNITISVTDTFHDQAHLMVRLEFLKLFLDTVNGCEAAIGQDFK
FT                   FVFNQSILTDDSVQLEVDLDNDLAWLTYFSDNKTLYGHVPDDMDPKKFTIPLTAYQGST
FT                   EDTMDFVLDVLKASDTHSNPTDPFTDTGSPDHKKAGIIAISVVVPLVVILSLLILFCCW
FT                   RSRKNSPTIEEGTSDRKAPPRPVRPDVPNCQPSMTERPSRDDNSDDWMSPISPSSIPKL
FT                   ELGPAWNVASFDKRENPVNFVIPEPIIPPRSPARNSPTRGGFVPRRDTITQEDKPVEAV
FT                   SPSKKQNNRLSYTNSPVRRRTTNRSRREPLKPIQPRAMKRESLQSSKSKRYSKRSSGIS
FT                   SIASGLPVRFSGAGHGAGGFGPPGHGVVHTSWQNARASMINDESSLTNMAPMFSRPPAA
FT                   GRMRHSMASSIPENYRRMTLRTVEPDDSIISESDSLEAFVHSRAKHRNSSNPLFSAQIS
FT                   RRTSSGMRALDRNRSMRSRADTVSVSTFSDEYRQSMQDRPLSTAISASEYGDDNTTNNN
FT                   SRFSQYQSQTGLFPLAEGSAYGQSQLSIAQDYRGAISPLPQCWSENSMGSARQLEGQGN
FT                   SQPQKVNDENAMPPSSSMISDLDEHLSRKVNPNKGANHEWWLSSPVEPPRPLKNSDNRS
FT                   LPVASSGELAFV"
     atggcgttct ttctcaccat cgtgctggtt ttcctgtcag tcgccagtgc agcatccttg        60
     tctgccaatt atccgataaa cgcgcaattg ccacctgttg cacgagtttc acagcctttc       120
     cgatttgagt tcgcccaaag tactttcgcc aacaccgacg cggacactaa atactcgcta       180
     ttaaatgcac catcatggct cgaagtggac agcagcagtc tcgccctgta cggaacgcca       240
     gactcaagcg acagtggtgc caacgaattc aagcttgtgg catcaaatgg atcagaaaag       300
     gacagcatgg acgttacttt aattgtgaca gcagaccagg gaccgacggt gaacaaacca       360
     cttgtgcctc aactgcagaa atcgggacca gtctcatatc ctgccacgtt gttcattcat       420
     ccgggtcgtc aattctcgat tgagttcgat caggatacct tcgacaacac gcatccgtcc       480
     acgatatact acggaacttc gccgaacaac gcccctcttc ctccctggat caccttcgat       540
     ccggcagccc taaaatttgc tgggaatagc cctgctttcc caggcgccgg gcctcaaaca       600
     tttactttcc agctagtcgc atcagatgta gctggataca gtgcggccaa cgtgactttt       660
     gaactctcga tcggtcccca tatcctgaca ttcaatgaga cagtacaaaa cttcaacctc       720
     acaagaggag aagagttcaa tagccccaaa ttcactagcc ttctgtctat ggacggttcg       780
     ccggtttcta tcaaggagct ggaaaaagtc gatgctgaat tgccgaactg gctgaacctg       840
     gataaggaga atatatcgct gagcgggact ccacccaagg atgctgtgaa tcagaacatc       900
     accatttccg ttacagacac tttccacgat caagcgcact tgatggttcg cttagagttc       960
     ttgaagctat tcctcgacac cgttaatggc tgtgaggcag ccattggcca agacttcaaa      1020
     tttgtgttca atcagtccat cctcactgat gactctgtac aactggaggt cgatttggac      1080
     aatgacctcg cgtggcttac ctatttctcg gacaacaaga ctctctacgg acacgttcca      1140
     gacgacatgg atcccaagaa gttcaccata cctcttactg catatcaagg gtcgaccgaa      1200
     gacacaatgg acttcgtcct cgatgtgctc aaagcctcgg acacacattc gaatcccaca      1260
     gatccgttca ctgatactgg cagccccgac cacaagaagg ctggcatcat cgccatctca      1320
     gtcgtggtcc cattagtggt aattctgagt ctgttgattc tcttctgctg ctggcgtagc      1380
     cgcaagaact cacccacaat tgaggagggt acatccgaca gaaaagctcc accacgacct      1440
     gttaggccag atgtccctaa ttgccagcca tccatgacgg aaagaccctc gcgcgatgac      1500
     aattccgacg attggatgag tcctatatca ccgtcgtcga tccccaagct cgaacttggc      1560
     ccagcgtgga atgtggcatc atttgataaa cgggagaacc cagttaactt tgttatccct      1620
     gagcccatta ttccccctcg ctcacctgct cgcaactctc ccactcgtgg gggctttgtc      1680
     ccacggcggg acaccatcac ccaagaggac aaacccgttg aagccgtctc gccttccaag      1740
     aagcaaaaca atcgcctctc atacacgaac agccccgtgc gtcgtaggac caccaaccgg      1800
     tctcgacgag agccgttgaa gccgatccaa ccgcgggcca tgaagcgaga atctctccaa      1860
     tcttccaagt ccaagagata ctcaaagcgc tccagcggca tctcctccat tgcctctgga      1920
     ctgcctgtac gattcagcgg agccggccat ggcgccggcg gcttcggacc tcccggccac      1980
     ggcgtggtgc acacatcatg gcaaaacgcc cgagcctcaa tgataaatga cgagagcagc      2040
     ctaacaaaca tggcgccaat gttttcgcgt ccgccagcag caggacgcat gcgccacagc      2100
     atggcatcta gcatccccga aaactacagg cgcatgaccc tacgcactgt tgagcccgac      2160
     gactctatta tctccgaatc cgactccctg gaagcctttg tccacagccg ggccaagcac      2220
     cgcaactcct ccaaccctct tttctccgcg cagatcagcc ggcgcacttc ctccggcatg      2280
     cgcgcgctcg accgaaaccg cagcatgcgc agccgcgcgg acactgtctc cgtatcaacc      2340
     ttcagcgatg aataccgcca atctatgcaa gaccggccct tgtcgactgc gatctcggca      2400
     tcggaatacg gtgacgacaa caccactaac aacaacagcc gcttctccca atatcagagc      2460
     cagaccggtc tatttcccct tgctgagggc agtgcatatg gccagagcca gctgagtatt      2520
     gcacaagact accgcggtgc tatctccccg ctgccgcagt gctggagcga gaatagtatg      2580
     ggcagtgctc gacagttgga gggccagggc aactctcagc ctcagaaagt gaatgatgaa      2640
     aacgccatgc cgcccagctc gtctatgatc tcggatctgg atgagcatct gtcgcgcaag      2700
     gtcaacccta acaaaggcgc caatcacgag tggtggttgt cgtcgcccgt tgagcccccg      2760
     cggccgctga agaattccga taatcggagt cttcctgtag ctagtagtgg ggagctggca      2820
     tttgtttga                                                              2829
//

If you have problems or comments...

PBIL Back to PBIL home page