(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE242

PENCW_13.PE242       Location/Qualifiers
FT   CDS_pept        join(550223..550258,550608..550926,550983..551056,
FT                   551123..551207,551276..551482,551538..551824,5
FT                   51894..552205)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946642"
FT                   /orf_name="Pc16g02420"
FT                   /product="Pc16g02420 protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="CAP92912.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001831A3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H735"
FT                   /transl_table=1
FT                   /translation="MGQTLSEPVVEKTSSEGGDDCCVYGVSAMQGWRISMEDAHATVLD
FT                   LQAKYTGTDDKPTDPEHRLAFFGVYDGHGGDKVALFTGENLHKIVSRQDAFAKGDIEQA
FT                   LKDGFLATDRAILEDPRYEEEVSGCTASTAIISQKKIWVANAGDSRSVLGVKGRAKPLS
FT                   FDHKPQNEGEKARITAAGGFVDFGRVNGNLALSRAIGDFEFKKSPELSPEQQIVTAYPD
FT                   VTVHELTNDDEFLVIACDGIWDCQSSQAVVEFVRRGIAAKQPLAQICENMMDNCLASNS
FT                   ETGGVGCDNMTMSVIGLLQGKTKEEWYNQIAERVANGDGPCAPPEYGKSPEEPESFEDT
FT                   PDEYDLEMERSRGFSVRSGRIILLGDGTEVITDQNDEELFDQTEEDQDLTNQVQHESGT
FT                   RNDRQATPGPQGKQENGSGTSAQISESPASTDAEKEKPAS"
     atgggtcaga ccctatcgga gccggtggtc gaaaagacat cgtccgaagg cggggatgac        60
     tgctgtgtgt atggtgtgtc ggccatgcag ggctggcgaa tcagcatgga ggacgcccac       120
     gctacagtcc ttgacctcca ggcaaagtat accggcaccg acgacaaacc gacggatccg       180
     gaacatcgtc tcgccttctt tggtgtgtac gatggccacg gtggagacaa agtggcatta       240
     ttcaccggcg agaacctgca caagatcgtc tctcgacagg atgctttcgc caagggcgac       300
     attgaacagg ccttgaagga tggtttcctc gcgaccgata gggctatttt ggaagacccc       360
     cgttatgagg aggaggtgtc tggctgtact gcttccacgg ccattatctc acagaagaag       420
     atctgggtgg ctaacgctgg tgattcacga tccgtcttgg gtgtcaaggg acgcgcaaag       480
     cccctctcat tcgaccacaa gcctcaaaat gagggcgaga aggcccgtat cacggctgct       540
     ggtggcttcg tcgatttcgg ccgtgtcaat ggcaaccttg ccctgtcccg tgctatcggt       600
     gacttcgaat tcaagaagag ccctgagctc tctcccgaac agcaaatcgt caccgcatac       660
     cccgatgtga ccgttcacga gctgacgaat gatgatgagt tcctagtgat tgcctgtgat       720
     ggtatctggg attgccagtc ctcccaggct gtggttgagt ttgtccgtag aggcattgct       780
     gcgaagcagc ccctcgccca gatctgtgag aacatgatgg acaactgcct tgcctcgaac       840
     agtgaaaccg gcggtgttgg atgcgacaac atgaccatga gtgtcattgg actcctacaa       900
     ggcaagacca aggaggagtg gtataaccag attgcagagc gggttgcgaa cggggatgga       960
     ccttgtgctc cgcccgagta cggcaagtct cccgaggaac ccgaaagctt tgaggatacc      1020
     ccggatgaat atgacctgga gatggagcgt tcccgtggat tcagtgtccg ttcgggccgc      1080
     attattctcc tgggtgatgg cactgaggtc atcacggacc agaacgacga ggagcttttt      1140
     gaccagaccg aggaggacca ggaccttacc aaccaggtgc agcacgaatc aggtactcgg      1200
     aacgaccgcc aggccactcc gggtcctcag gggaaacagg agaatggcag cgggacatct      1260
     gctcagatat ccgaatcccc ggcttccact gacgccgaga aagagaagcc cgcatcgtag      1320
//

If you have problems or comments...

PBIL Back to PBIL home page