(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE243

PENCW_13.PE243       Location/Qualifiers
FT   CDS_pept        join(553385..553893,553997..554347,554400..554808,
FT                   554887..555024)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128418"
FT                   /orf_name="Pc16g02430"
FT                   /product="Pc16g02430 protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP92913.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001831A3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H736"
FT                   /transl_table=1
FT                   /translation="MSPSTSPAGKRKRSASHLPAPVPKNVTADLQPSSRDASGEEGGED
FT                   STGPANANSNSSNGTRHPSKRARKAAAADAASHTEVNGVEPVNKEDPGEPSETTVASSD
FT                   IEGGPRSRPGLHIDLPEDDEPVTEEQMAPPVFGRLQDPVGYHTNPPPTGRPVRVYADGV
FT                   FDLFHLGHMRQLEQAKKAFPDTYLIVGVTGDEETHLRKGLTVLSGAERAETIRHCKWVD
FT                   EVIPCCPWIVTPEFLSEHKIDYVAHDDLPYGAAEGDDIYAPIKEQGKFLVTQRTEGVST
FT                   TGIITRVVRDYDQYISRQFKRGASRQELNVSWLKKNELEIKRHVAELRDNIRNNWTMTG
FT                   QELGRELRQIWQNSRPNSPAPSARNSMDWGMRGPLTSPTGGSKSHLSRVGAEHNRADSP
FT                   MGSRRNEDFATGYSLGLIGGVRAWMARSRQSLQEPPSGMHSPTDEELEPEHNNGYEEEV
FT                   RGRTGHVSAK"
     atgtcgccat ctacctcacc cgccggtaag cgcaagcgca gcgcctccca ccttcccgcg        60
     cccgtcccaa agaacgtcac agccgacctc cagccgtctt cacgcgacgc gtccggcgaa       120
     gaaggcggcg aggactcaac ggggcctgcc aatgccaact ccaacagctc caatggcacc       180
     cgccaccctt ctaaacgggc ccgcaaggct gctgccgccg atgccgcaag tcacaccgag       240
     gtaaacgggg tcgagccggt caacaaggaa gaccccggcg agccatctga gacaactgtc       300
     gctagcagcg atattgaggg tggtcctcgg tcgcgccccg gtttacatat cgacttgccc       360
     gaagatgatg agcctgttac agaggagcag atggcacccc cggtttttgg acgcttgcag       420
     gatcccgtgg gttaccacac caacccgccc ccaacgggtc gcccagtacg cgtgtatgcg       480
     gatggtgtct ttgatttatt ccaccttggc cacatgagac agcttgagca agctaagaag       540
     gccttccccg atacttatct gattgttggt gttactggcg atgaggagac acacctgcgc       600
     aagggtctga cagtgctcag cggcgccgag cgcgccgaga ccatccgtca ttgcaagtgg       660
     gtcgacgagg ttatcccctg ctgtccgtgg attgtgactc cggagttcct gtctgaacac       720
     aagatcgact atgttgccca tgacgatctg ccctacgggg ctgctgaggg tgatgacatc       780
     tacgcgccta tcaaggaaca gggcaagttc ctggtgacgc agcgtacaga gggtgtcagt       840
     accactggta tcatcacacg ggttgtccgc gactacgacc aatatatctc ccgtcaattc       900
     aagcgcggcg cctcacgcca agaactcaac gtttcctggt tgaagaagaa cgagctcgag       960
     atcaagcgtc acgtcgccga gctgcgtgac aacatccgca acaactggac catgaccggc      1020
     caggagctcg gccgtgaact gcgtcagatc tggcagaaca gccgccctaa cagccccgcg      1080
     cccagcgccc gcaacagcat ggactgggga atgcgtgggc ctctcaccag cccgacaggg      1140
     ggcagcaagt cgcacctgtc gcgtgtaggt gcggagcaca accgggcaga tagccccatg      1200
     ggctcgcgcc gcaatgagga ttttgctact gggtacagtc ttggtctgat cggaggtgtg      1260
     cgtgcttgga tggcccgcag ccgccaatcc cttcaggaac cccctagcgg catgcacagt      1320
     cccaccgacg aagaactcga gcccgagcac aacaacggct acgaggagga ggtgcgtggt      1380
     cgtaccggtc acgtctctgc gaagtag                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page