(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE246

PENCW_13.PE246       Location/Qualifiers
FT   CDS_pept        join(complement(559360..559761),complement(558277..559272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946644"
FT                   /orf_name="Pc16g02460"
FT                   /product="Pc16g02460 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92916.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI0001831A41"
FT                   /db_xref="UniProtKB/TrEMBL:B6H767"
FT                   /transl_table=1
FT                   /translation="MVSPNLDSASGTGQYQDHPDAPLPIRVEQSESNSRSEQRSSSTQT
FT                   QTYRDDERGYCESDEAESQPALTQSDPIPIEDDDEAIAIAAASRPRHAWQVWWLRNKGM
FT                   GLVLLAQAFAASMNVMTQVLEIHSSMHPFQILFARMSITAVASYLYMYIASTPSPLGTR
FT                   PVRGLLLLRALFGFTGVYGLYYSVQYLPLSEATVITFLSPIMSCYACSLLIPGETFSRK
FT                   QLLAGLISLGGVVLIARPFSKRDPSMTIATPTATTAWVLGLSTSTVDKPPSETDSYHHV
FT                   MATIVAFLGVLGASGAYTSIRMIGRRAHPLVSVTYFSSVTTVISFVAMLTVPSVPFRVP
FT                   NTVVEWMLLTGLGVCGFLLQFLLTAGLSYVPPASVSDGKPTAQGARATSMVYMQMFFAV
FT                   FYDKVVWGSTLSPISWVGSGIILACAVYVAFAQESPVQQGSGSAEYRDVAGYKDATDEE
FT                   RAEERGN"
     atggtcagtc caaatcttga ttcggcctcc ggtactggtc aataccagga tcatccagac        60
     gcgcccctgc cgatccgggt ggagcagtcg gaatcgaact cgagatcgga gcagagatcg       120
     tcttcaacgc aaacgcaaac ctaccgcgac gatgaacggg gctactgcga aagcgacgaa       180
     gccgaatccc aaccagcact gactcagtca gaccccattc ctatcgagga tgacgatgag       240
     gccatcgcaa ttgccgcggc ttcgcgaccc cgccatgcat ggcaggtatg gtggttgcgc       300
     aataagggta tggggcttgt cctgttggcg caggctttcg ctgcctcgat gaatgtcatg       360
     acgcaggtct tggagattca tagttccatg catcctttcc agatcctctt cgcccgcatg       420
     tccataacag cagtcgcaag ctacctatac atgtacatcg cctctacacc ctccccactt       480
     ggcacacgcc ccgtccgcgg tctcctcctc ctccgcgcgc tcttcggctt cacaggcgtc       540
     tacggcctct actactccgt gcaatacctc cccctctccg aagcaaccgt gatcaccttc       600
     ctctccccga taatgtcctg ctacgcctgc tcgctcctca tccccggcga gaccttttcc       660
     cgcaaacagc tcctcgccgg ccttatctct ctcggcggcg tcgtgctcat cgcccgcccc       720
     ttcagcaagc gcgaccccag catgaccatc gcaaccccaa ccgccaccac agcctgggta       780
     ttaggcctgt ccacttcaac ggtcgataaa cccccttccg aaacagactc ctaccaccat       840
     gtcatggcga cgatcgtcgc tttcctcggc gtgctcggtg cttcgggtgc ttacacttcc       900
     atccgtatga tcggccgtcg tgcgcatccc ctcgtctccg ttacgtactt ctcgtccgtg       960
     acgacggtta tttcgttcgt tgcgatgttg accgtgcctt ctgtgccgtt ccgggtacct      1020
     aacaccgttg tggagtggat gctgttgacg gggctgggtg tctgcggatt cctgttgcag      1080
     tttttgttga cggcgggttt gtcgtatgtc ccgcctgcgt ctgtgtcgga tgggaagccc      1140
     acggcgcagg gggcacgtgc cacatcgatg gtttacatgc agatgttctt tgcggtgttt      1200
     tatgacaagg tggtttgggg gagtacgctg agtccgatta gttgggttgg gtcggggatt      1260
     atcttggcct gtgcggtgta tgtggcgttt gcgcaggaga gtcctgttca gcaagggagt      1320
     ggcagtgcgg agtatcgcga tgttgcagga tacaaggacg ccactgacga ggagagagcg      1380
     gaggagaggg ggaattga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page