(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE247

PENCW_13.PE247       Location/Qualifiers
FT   CDS_pept        join(complement(564322..564452),complement(563753..564275),
FT                   complement(562201..563694))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946645"
FT                   /orf_name="Pc16g02470"
FT                   /product="Pc16g02470 protein"
FT                   /protein_id="CAP92917.1"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniParc:UPI0001831A42"
FT                   /db_xref="UniProtKB/TrEMBL:B6H768"
FT                   /transl_table=1
FT                   /translation="MPAPRGSGSFRGARGRGGRGRGRGRGRGGQGRNSFATSRLNESDT
FT                   RSDDSSGGEDDASEQSQEELDDDTLMDEGSSSDEEDENTERPYNELLQLLQPNESSGPA
FT                   RKKRKIATDPNAEVQIAQPAEEPEQGDDDLEAQAPSDDEEEEADEDEDPTAPFEKHFDL
FT                   RDSADLTKQIEPIQSNKWASVKKEVDGLRLVHTVPDTGANSAPILPPLKSTTNIKLKQK
FT                   LKSRAAEILPKITGQAQIIAPYVFNYQDVLYGARTTSNANEIRDIMALHSVNHLLKTRD
FT                   QVLKNNARLAKDPDTDIECRDQGFTRPKVLYILPTRQACVKVLDAITRIYQPEQQENKK
FT                   RFTDSFSAPNDDSWEHKTEDFRELFGGNDDDMFRLGLKFTRKTVKYFAQFYSSDIILAS
FT                   PLGLRTIMDQSDAKKRDHDFLSSIELVVVDHADALLMQNWDHVDYIFQHLNLQPKQAHG
FT                   CDFGRVRNWYLDNQARHVRQTVVVSSYITPEINALFSSQMQNASGRLKATPTYAGAITE
FT                   LPLAVPVKQTFTRIDSTSPIKDPDARFKHFTTTILSTLVKNITHGRGKGGAGTLIFIPS
FT                   YLDFVRVRNHFATSTQTTNVSFGAISEYTESKEANRARSHFMSGRHSVLLYTERAHHFR
FT                   RYQVRGVKRVVMYGLPDNAMFYGEIVGFLGLDPAALIEAAEGGVRALFSKWDALKLERV
FT                   VGTSRTGNMLREKGGDTFTFV"
     atgcctgctc ctcgtggttc tggttctttt agaggagctc gaggccgtgg tggccgtgga        60
     cgtggccgag gtcgcggtcg tggtggtcaa ggtcgcaact cctttgccac ttcgcgattg       120
     aatgagtccg atactagatc agacgactct tctggcggag aagatgatgc cagcgagcaa       180
     tcccaagagg aattggatga tgacaccctt atggatgagg gctccagcag cgacgaagaa       240
     gacgagaata ctgaacgccc ttacaacgaa ctccttcagc tacttcaacc caatgagtca       300
     agcggaccag ctcggaagaa gcgcaagatc gccaccgacc caaacgctga ggttcaaata       360
     gcgcaacccg cagaggaacc agagcagggc gatgatgatt tggaagccca agcgccgtcc       420
     gacgatgaag aggaggaagc agacgaggat gaggacccaa ctgctccttt tgagaagcac       480
     tttgatctcc gtgatagtgc agatctgacc aagcagattg agcctatcca atcgaacaaa       540
     tgggcatccg tcaagaaaga ggtggatggg ctacgactgg tacatactgt tcccgacaca       600
     ggagcaaaca gcgcaccaat ccttccgcca ttgaagagca caaccaatat caagcttaaa       660
     caaaaattga agtctcgcgc ggccgagatc ctgcctaaaa tcaccggtca agcccagatc       720
     attgcgccat atgtgttcaa ctaccaagac gttctctacg gtgcccgcac tacttccaat       780
     gcaaatgaga tacgcgatat tatggctttg cactctgtca atcacctgct gaagacccga       840
     gaccaggtcc tcaaaaacaa cgcccgtctg gccaaggacc ccgacaccga tatcgagtgc       900
     cgtgaccaag gatttacccg acctaaggtg ctttacattc tgcctacccg acaggcatgt       960
     gtcaaggttc tcgatgcgat cactcggatc tatcaacccg aacagcaaga aaacaaaaag      1020
     cgcttcaccg actcgttttc agcgccaaat gatgattcct gggaacacaa gaccgaggat      1080
     ttccgggagc tcttcggcgg caatgacgac gacatgttcc gactaggtct caagttcacg      1140
     cgcaagacag tgaaatattt cgcgcaattc tacagctccg acatcattct agccagtcca      1200
     ctgggtctac gtacgatcat ggaccagtcc gacgccaaga agcgcgatca cgacttcctc      1260
     tcctcaattg agctggtagt tgtcgaccac gccgacgccc tcctcatgca aaactgggac      1320
     cacgtcgact acatcttcca gcacctgaac ctgcaaccga agcaagcgca cggctgcgac      1380
     ttcggccgcg tccgcaactg gtatttggat aatcaagccc gccatgtcag acaaactgta      1440
     gtagtctcat cctacatcac ccccgagatc aatgcgctct tctcgtccca gatgcaaaac      1500
     gcctcgggcc gtctcaaagc aacccccacc tacgccggcg ccatcaccga gctcccactc      1560
     gcagtccccg tcaagcaaac cttcacccgc atcgacagca catcgcccat taaagacccc      1620
     gacgcgcgct tcaagcactt cacaacaact atcctgtcca cgctggtgaa gaacatcacg      1680
     cacggccgcg gaaagggcgg ggccggcacc ctcatcttca tcccctccta cctcgacttc      1740
     gtccgcgtgc gcaaccactt tgctacctct acgcagacaa ccaacgtctc ctttggagct      1800
     atctccgagt acaccgagtc gaaggaggct aaccgtgccc gcagccattt catgtctggc      1860
     cgccactctg tgctcctata taccgagcgc gcgcaccact tccgccgtta ccaggtccgt      1920
     ggtgttaagc gtgtggtcat gtacgggctc ccggataacg cgatgttcta cggcgagatc      1980
     gttggattct tgggtcttga tcctgcggcg ttgattgagg ctgctgaggg tggtgttcgt      2040
     gcgctgttct cgaagtggga tgcgttgaag ttggagcgcg ttgttggtac gtctaggact      2100
     gggaatatgt tgcgggagaa ggggggtgac acgtttactt ttgtatga                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page