(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE248

PENCW_13.PE248       Location/Qualifiers
FT   CDS_pept        join(564676..564777,564828..565540,565596..565800)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977314"
FT                   /orf_name="Pc16g02480"
FT                   /product="Pc16g02480 protein"
FT                   /protein_id="CAP92918.1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0001831A43"
FT                   /db_xref="UniProtKB/TrEMBL:B6H769"
FT                   /transl_table=1
FT                   /translation="MAEDSFLHLARPLGPVSVGTAPTTAPLNVVIQPQAIFSVLDHSLR
FT                   RNADQERVIGTLLGTRSEDGSEVEVRSAFAVGHSEAEDQVEVDMEYHKQMLALHLKANP
FT                   REVLVGWYATASELNTFSALIQNFYSGQGDGTWPHPAVHLTVSTEAGKDLETRAYISAP
FT                   VGVTAERAADSAAFIPVPYELRYGEADKSGLESIANAKDAEDRSTSVTSDIESLERAIE
FT                   EVLSMVDRVSRYVESVIDEETPASTAMGQFLLNALALAPKVEPADIERDFNNHIQDVLV
FT                   VSYLANTVRTQMELSTRLATAQLTLGGGGEGPATEGQRNQRGKGQGRPRQDRAEEARA"
     atggccgaag attctttcct tcatctcgct cgccccctcg gccccgttag cgtggggacc        60
     gctcctacca ctgcccctct gaacgtggtc attcaacccc aggccatctt ctcagttctc       120
     gaccactctc ttcgccgcaa tgccgaccag gagcgagtca tcggtacact cctcggaaca       180
     cgatctgagg atggaagcga ggtcgaggtc cgatccgcct tcgccgtcgg ccactccgag       240
     gctgaggacc aggtcgaggt cgatatggaa taccacaagc agatgcttgc tttgcacctg       300
     aaggccaacc cccgcgaagt cttggttggc tggtacgcca ctgcctctga gctcaacact       360
     ttctccgctt tgatccagaa cttctacagc ggccagggtg acggtacctg gcctcaccct       420
     gctgtccacc tgactgtctc tactgaggct ggaaaggatc tcgagactcg cgcctatatt       480
     tccgcccccg ttggtgtcac cgctgagcgt gctgccgaca gcgctgcttt cattcccgtt       540
     ccctacgagc tccgatacgg cgaggccgac aagagtggtc ttgagtctat cgccaacgcc       600
     aaggatgctg aggaccgttc cacttccgtc acttccgaca ttgagtctct tgagcgcgcc       660
     attgaggagg tcttgtccat ggttgaccgc gtctcacgct acgtcgagtc cgtgatcgac       720
     gaggagaccc ccgcttcgac tgccatgggc cagttcctgc ttaatgctct cgctctcgcc       780
     cctaaggtcg agcctgctga catcgagcgt gacttcaaca accacatcca ggacgtcctg       840
     gtcgtttctt acctcgccaa caccgtgcgc acacagatgg agctttctac tcggctagca       900
     accgcccagc ttaccctcgg cggtggcggc gaaggccccg ctaccgaggg ccagcgcaac       960
     cagcgtggca agggtcaagg ccgcccacgc caggaccgcg ccgaggaagc ccgcgcatga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page