(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE249

PENCW_13.PE249       Location/Qualifiers
FT   CDS_pept        join(complement(568120..568144),complement(566955..567817))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128420"
FT                   /orf_name="Pc16g02490"
FT                   /product="Pc16g02490 protein"
FT                   /protein_id="CAP92919.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831A44"
FT                   /db_xref="UniProtKB/TrEMBL:B6H770"
FT                   /transl_table=1
FT                   /translation="MVDLLGDKACSWSPARQHACRYQSHVNLFYGVSNRGVWSLGSNLI
FT                   LKERSTEPPNFEVPNIRFLASKTSIPIPRIVEEWQEDDGACFLLTRRIRGQPLSELWPT
FT                   MTSADKERVAKQTAEYLMIQLHELRSNRMESIGGQPIYSAFLFPHTYGIGHGPFSSDDE
FT                   LWAEMSLTLNDQVPEQVRSKLRQRMPTAAPYTFTHGDLTNVNIMVENGNLAGILDWESS
FT                   AFFPVWWEFTCAGIGLGQDDKEWKDLLRSHLPDHTEARNFWLDFFAIHNYPNLNERGLA
FT                   LLKECDLDLPEKET"
     atggttgatc tccttggcga taaagcgtgt agctggtcac cagcacgtca acatgcatgt        60
     cgttaccaga gccacgtcaa ccttttctac ggcgtcagca accgaggggt gtggtctcta       120
     ggctcaaacc tgatcctaaa agaacgatct accgagccac ccaactttga agtccctaat       180
     atcagatttt tggcgtcaaa gacctcaatt cctatacctc gaatcgttga agaatggcag       240
     gaagacgacg gggcatgttt tcttcttacc agacggattc gaggtcaacc actgagtgaa       300
     ttgtggccga cgatgacatc ggctgacaaa gaacgtgtcg cgaagcagac cgctgaatac       360
     ttgatgatac aacttcatga gcttcgctcg aaccgaatgg aaagtatcgg cgggcagcca       420
     atctactcag cctttctttt cccgcataca tatggtattg ggcatgggcc gttttcatct       480
     gacgatgaac tatgggcgga gatgtcgtta accttgaatg atcaagtgcc ggagcaagtt       540
     cgttcgaaat tgcgtcagcg gatgccaact gcggctccct atacttttac tcacggcgat       600
     ctgaccaatg ttaacattat ggtcgaaaac ggtaatctgg cagggatcct agattgggaa       660
     tcttcggcct tttttcctgt ttggtgggaa tttacttgtg caggaattgg tctgggccaa       720
     gatgataaag aatggaaaga tttgcttcgc agccacctgc cagatcatac cgaggcccgc       780
     aatttctggt tggatttctt tgcaatacac aactatccta acttgaatga gagaggactg       840
     gcacttctaa aggaatgtga tctagatctg ccagagaaag aaacgtga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page