(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE250

PENCW_13.PE250       Location/Qualifiers
FT   CDS_pept        join(568592..568672,568821..569007,569100..569218)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671379"
FT                   /orf_name="Pc16g02500"
FT                   /product="Putative uncharacterized protein Pc16g02500 "
FT                   /protein_id="CAP92920.1"
FT                   /db_xref="UniParc:UPI0001831A45"
FT                   /db_xref="UniProtKB/TrEMBL:B6H771"
FT                   /transl_table=1
FT                   /translation="MPRLWLLYATHDLLRDRALRYVDYLVSVVPTNSGTTSCDVLLPVV
FT                   DHGTIFVEIRDETTSGYTRQLAVQHRTSGTASNLQVVVLLLVFKDYVNQKKPLKRHKKI
FT                   IREDYLRPPDYDRISGRLFLSIVK"
     atgccacggc tctggctcct gtatgcgacg catgatcttc tcagagaccg cgccctccgt        60
     tatgtggact acctggttag tgtagtacct acgaactccg gaacaacatc atgcgatgta       120
     ctacttccag tggttgatca tggcaccata ttcgtggaaa ttcgggatga aacgacctcg       180
     ggatatacta ggcaattggc ggtccaacat cgaacaagtg gaacagcctc aaatttacaa       240
     gtggtggtgt tgctcttagt gttcaaagac tatgttaacc aaaaaaaacc actaaaaaga       300
     cacaaaaaga ttatcaggga agactacctg agaccaccag actatgatcg cataagtggc       360
     cgactattct tgtctatagt aaagtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page