(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE251

PENCW_13.PE251       Location/Qualifiers
FT   CDS_pept        join(complement(569965..570025),complement(569394..569890))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946646"
FT                   /orf_name="Pc16g02510"
FT                   /product="Pc16g02510 protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /protein_id="CAP92921.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0001831A46"
FT                   /db_xref="UniProtKB/TrEMBL:B6H772"
FT                   /transl_table=1
FT                   /translation="MAEPRARMARHKGQMNFQNELRLLLLAYGDPSPHPSFPNEPLPET
FT                   VRVLDEIVTDFVLELSHGAAQVAHHARRQKIKVEDFRFALRRDPNKLGRVQELLRMERE
FT                   LKEARKAFDQNDDQVAKEAGKKGAAAAAAAAAAGEDPVAAEAAATATVTKKSKGKGKRG
FT                   AAIRRGSDATEESVSKKRKTIG"
     atggccgaac cacgcgcgcg catggcccga cacaagggcc aaatgaactt ccagaatgag        60
     cttcgcctgc tgcttcttgc ctacggcgac cccagcccgc accccagctt cccaaacgaa       120
     ccacttcccg agacagtccg cgtgctggac gaaatcgtca ccgactttgt gctggaactc       180
     agccacggtg ctgcgcaagt cgcgcaccac gcccgccgtc agaagatcaa ggtggaggac       240
     ttccgcttcg cactacgtcg cgacccgaat aagcttggtc gtgtccagga gctgctgcgc       300
     atggaacgtg aattgaagga ggcccgcaag gcatttgacc agaatgatga tcaggttgct       360
     aaggaagctg gaaagaaggg tgctgccgcg gcggccgcgg cggctgctgc tggtgaggac       420
     cccgtggctg ctgaagctgc tgctactgct acggttacca agaagagcaa gggcaagggg       480
     aagagaggtg ctgcgatccg tcgaggatct gatgctactg aggagtcggt ttcgaagaag       540
     cgcaagacga tcggctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page