(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE252

PENCW_13.PE252       Location/Qualifiers
FT   CDS_pept        join(570692..570733,570822..570931,571004..571178)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946647"
FT                   /orf_name="Pc16g02520"
FT                   /product="Pc16g02520 protein"
FT                   /protein_id="CAP92922.1"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniParc:UPI0001831A47"
FT                   /db_xref="UniProtKB/TrEMBL:B6H773"
FT                   /transl_table=1
FT                   /translation="MVSSCTCQDLWHCCSALFNFQSLLLVILLIICTSSYAHSIMPGIM
FT                   DRNQNGIFGIFWKCARVGERLSPYVSICCVVMAVSSLFHKPRYMKKDTDIACRSQSSSV
FT                   VNLA"
     atggtgagtt catgcacatg tcaggattta tggcactgct gttccgctct tttcaacttc        60
     cagtccttgc tgcttgtgat tctcttgata atttgcacga gtagctatgc gcactcgata       120
     atgcccggga ttatggaccg gaaccagaat ggaatctttg ggatcttctg gaagtgtgcc       180
     cgagtcggag agcgactaag tccgtacgtc agcatatgct gtgtcgtgat ggcagtaagt       240
     tccctcttcc acaagcccag atatatgaag aaagatactg atattgcatg caggtctcaa       300
     tcttcttcgg tggttaacct tgcttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page