(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE253

PENCW_13.PE253       Location/Qualifiers
FT   CDS_pept        complement(571478..573880)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946648"
FT                   /orf_name="Pc16g02530"
FT                   /product="Pc16g02530 protein"
FT                   /protein_id="CAP92923.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI0001831A48"
FT                   /db_xref="UniProtKB/TrEMBL:B6H739"
FT                   /transl_table=1
FT                   /translation="MSSCPHQLVRSRLNGLLSPQCRSAGRWYRESGTANVGHRVRLSTY
FT                   NAPAILEPGVTHDTPDPVSYQHNRGSTSSSHPPTSEQSDQVANDRYGMGHGQTKPPTQS
FT                   RKSSQTPIITNDKMKKVAYVRQADPKLVAMAAERVNREILNKGRHLTDRGLYLSLAMRM
FT                   NSLYTRDLGLRQWKEAYGAIHKAKTYGREVLHKAALPKLREDGEQLLALLLNDCQGKFR
FT                   EAWLAMNRATRAWAWQRLAGWLLQNNPAMALEFLLVTTEPRDKPDFTMVVDCLAYLEKF
FT                   HYEELRDWTKGVHTFESVVATCLDPKDWPIISPPQKGIRFYIRRAGFLGVYESFRLMNE
FT                   RGITMEAQTALCYMYRFTQLNDVEYALRALEFIPKINDPGFSMDSEGVLRHCCKLLTLD
FT                   TVEDKAGGRNFRILPRLLKMGVQPDRDMMNIVLANAYKTGDPQLGADMLQFMKNHHHDF
FT                   DSYTYLTLLTDAVSRGDRGRVDELVREVEMQEDIRNNPYIFSKIFHAHFTFTAKHIDPE
FT                   SDPAGVFYSMLDMYNKIHDITPLKELLLLPPHYTAPPTQGLEVKTPPSPVSLFLMIATF
FT                   FRCRNRISQVHHMYDRFRELVQQGHPSIAPLVETDHVYNEFLIAFRKSSRGLRSSIRLV
FT                   EDMLDASALPKETTAGKPLKHVSPTPRTWTILLSAFNYSRQPDAAEKVKEMMAKHDVEY
FT                   NQVTWNTIINGYANAQDIPETANAIKKMEKDGFAIDHYTMKSLRYLRDPERLWVAIEEM
FT                   DEGLDLDGTHKLLTLEPASDVHTDQKEQDELIDNGLEKLESKLKPKM"
     atgtcatcgt gtccgcacca actcgttcgg tcccgtctca acgggttact ctcaccacaa        60
     tgtcggagcg caggccgatg gtatcgggag tcggggacag cgaatgtcgg tcatagagtg       120
     cgcctctcca catacaatgc ccccgcaata ttagagcccg gcgtaacgca tgatactcct       180
     gaccccgtgt catatcaaca caaccgcggt tcgacaagca gttcacatcc accgacaagt       240
     gaacaatcag atcaggtcgc aaacgatcgg tatggcatgg gccatggaca aacgaaacct       300
     ccaacccaat ctcgaaagtc gtcacagaca ccgattataa caaatgataa aatgaagaag       360
     gtcgcctatg tgcggcaagc cgatcccaag cttgtggcca tggcggccga gagagtcaac       420
     cgcgaaatct tgaacaaggg tagacatttg accgatcgag ggttatacct gtcgcttgcg       480
     atgcggatga attcgcttta tacgcgtgat ctgggactcc gccagtggaa ggaggcatat       540
     ggcgcaattc acaaggccaa gacatatggc cgcgaggtct tgcacaaagc tgcattgcca       600
     aaactgagag aagatggcga gcaactgcta gccttgctac ttaatgactg tcaaggcaaa       660
     tttcgagagg catggcttgc aatgaaccgt gctaccagag cctgggcctg gcaacgcctc       720
     gccggttggc tgctgcaaaa taacccggca atggccttgg agtttttact cgtcacgacc       780
     gaaccacggg ataaaccgga ttttactatg gttgtcgatt gtttggccta cttggagaaa       840
     tttcattatg aagagctccg ggattggacg aagggtgtcc acacattcga atcggttgtt       900
     gcgacttgcc tggatccgaa ggactggcca attatctccc caccacaaaa gggcatacgc       960
     ttctatattc gccgagcagg cttcttaggt gtctatgaga gtttccgttt aatgaacgag      1020
     cgaggcatca ccatggaagc acaaacagca ctttgctaca tgtaccgatt cacacagctg      1080
     aatgacgtgg aatatgccct cagggctctc gaattcattc ccaaaatcaa tgaccctgga      1140
     ttttccatgg actctgaagg cgtcctacgg cactgttgca agcttttgac cctggacact      1200
     gttgaggata aggctggagg acgcaatttc cggatcctcc cacggcttct taaaatgggt      1260
     gtccagccgg accgagacat gatgaatatt gtactcgcca atgcctacaa gaccggtgac      1320
     cctcaattgg gtgcggacat gcttcagttc atgaagaatc accaccacga tttcgattct      1380
     tatacatact tgacactcct cactgacgcg gtgtctcgag gtgaccgggg ccgtgtggac      1440
     gaattggtgc gggaagttga gatgcaagag gatatacgaa acaacccata catttttagc      1500
     aaaatcttcc acgcccattt cacttttacc gccaagcata ttgaccccga gagcgacccc      1560
     gccggagttt tctactctat gctggacatg tacaacaaaa tccacgacat cacaccgctc      1620
     aaagaactcc ttctactccc tccccactat accgcgccgc caactcaagg acttgaagtc      1680
     aaaaccccac cttctccggt atccttattc ctcatgatag caacattctt ccgttgcagg      1740
     aatcggatat cacaagtgca tcatatgtat gacagattcc gcgagctcgt gcagcagggc      1800
     cacccatcca tcgcccctct ggtcgaaact gaccacgtct ataatgaatt cctcattgcc      1860
     ttccgcaaga gcagccgtgg actacggtca agtatacgcc ttgtcgaaga catgcttgac      1920
     gcatctgccc tgccgaaaga gactactgct ggcaagcctc tcaagcacgt ctctcccacg      1980
     cctcgcactt ggactatcct cctcagtgcc ttcaattaca gtcgccagcc cgatgccgct      2040
     gagaaagtca aggagatgat ggccaagcac gacgtggagt acaaccaggt gacctggaac      2100
     accatcatca acggatacgc gaatgcacag gacatcccgg aaaccgctaa tgcaatcaag      2160
     aagatggaaa aggatggctt cgccattgac cattacacga tgaagagttt gcgttatctc      2220
     cgagaccccg aacgtctctg ggtggcgatc gaggagatgg atgagggcct tgatttagat      2280
     ggaacccata agcttctcac tctcgagccc gcatctgatg tgcacactga tcagaaggag      2340
     caagacgagc tgattgacaa tgggttagag aagttggagt caaagttgaa acctaagatg      2400
     taa                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page