(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE254

PENCW_13.PE254       Location/Qualifiers
FT   CDS_pept        574183..574785
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977315"
FT                   /orf_name="Pc16g02540"
FT                   /product="Pc16g02540 protein"
FT                   /protein_id="CAP92924.1"
FT                   /db_xref="InterPro:IPR013169"
FT                   /db_xref="UniParc:UPI0001831A49"
FT                   /db_xref="UniProtKB/TrEMBL:B6H740"
FT                   /transl_table=1
FT                   /translation="MSSSHANLDAASTDRKARLAKLAALKRKQPEQDTNEAGAVDRELP
FT                   DADTTPDVTAKYLSGRNYDPETRGPKLGFEQGPQEGQVTLEAQAAEIARATAEQSKEDT
FT                   GADEPLDLFKLQPKKPNWDLKRDLDEKLKILNVRTENAIARIVRQRVEDAKRAAKARGP
FT                   KSNGDEEGEEVGMEGETLVEGIHMREREEEKSDEETI"
     atgtcgtcaa gccatgccaa tcttgatgcg gcatccaccg accgcaaagc ccggctcgcc        60
     aagctcgcag ctctgaagcg caagcaaccc gaacaagaca caaacgaggc cggtgcagta       120
     gaccgggagc tgcccgatgc cgacaccacg ccagatgtga ccgcaaaata cctgtctggc       180
     cgcaactacg accccgagac ccgcgggcct aagctgggct tcgagcaagg cccgcaagag       240
     ggccaggtga cgctggaagc acaggcggct gaaattgcaa gggccacagc ggagcaatcc       300
     aaggaggaca cgggtgctga tgagcccctt gatctgttca aactacaacc taagaaaccc       360
     aactgggact tgaagcgcga tctggacgaa aagctcaaga ttctcaatgt acggacggaa       420
     aatgcaattg cccgaatcgt gcgacagagg gtagaggatg cgaagcgtgc tgcgaaggca       480
     cggggaccta agtctaacgg agacgaagag ggagaggaag tgggcatgga gggtgagacg       540
     cttgttgagg gcatccatat gcgcgagcga gaggaagaga agagcgacga agaaacgatt       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page