(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE255

PENCW_13.PE255       Location/Qualifiers
FT   CDS_pept        join(complement(576095..576189),complement(575911..576069),
FT                   complement(575191..575839))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977316"
FT                   /orf_name="Pc16g02550"
FT                   /product="Pc16g02550 protein"
FT                   /protein_id="CAP92925.1"
FT                   /db_xref="UniParc:UPI0001831A4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H741"
FT                   /transl_table=1
FT                   /translation="MNRYRNAPRLGGSNSNKATATTLCQKCLGRDILLTNSDPRHYSFD
FT                   CKASAQERPYIPRPSRTQQLLNPELMPKLSSENPNELLRKEGVADELLATREEERGRKR
FT                   DLDDMTDRNAQSPGRARSLSVETISTNRSYSSSPRRNKRGAADRGRRDDSSAPPAKSRK
FT                   RRYSDSTEGSSGSVHSGPKDRSPSRERTRTDDRNTRRRRRESSPEERGRHRRAGRHSER
FT                   RDRRSKSLDKDRVEESRATAQDVPKDRSYRDRASPPRQSQHERSRPDPIMQKNQPPRER
FT                   SLSPFSKRLALTQAMNNGR"
     atgaaccgat atcgaaacgc cccaaggctc ggaggctcca actccaacaa ggccaccgcg        60
     accacactgt gccaaaaatg cctcggacga gatatacttt tgactaactc cgatccacgg       120
     cactatagct ttgattgcaa ggcatccgcg caagagcgcc catacatccc gcgaccttca       180
     aggacccagc agctactgaa tccagaattg atgcccaagc tttcaagcga gaatccaaat       240
     gagctgctgc ggaaagaggg tgtagcggat gaactacttg ctacccggga ggaagagcgt       300
     ggccggaaga gagaccttga cgatatgaca gatcgcaacg ctcagtctcc ggggcgggct       360
     aggtccctct cagtggaaac gatatccacg aatcgatcct attcctcgtc tcctcgccgc       420
     aacaagcgcg gcgcagccga cagaggccgc cgagatgatt catcagcacc gcctgcaaag       480
     tcccgaaaga gacgctacag tgattctacc gagggttctt ctgggtcagt ccactcaggc       540
     ccaaaggacc gctcaccctc ccgggaacga actcggactg atgatcgaaa cactcggcga       600
     cggagacgag aatctagccc cgaagaacga ggtcgccacc gtagagcagg aagacatagc       660
     gagcgaagag accgccgaag caagagtttg gataaggatc gagtggaaga atcacgtgct       720
     acggctcagg atgttcccaa ggaccgatca taccgtgatc gagcaagccc accacgccag       780
     tctcaacatg aacggtctcg gcctgatccc ataatgcaga agaatcagcc tcctcgggaa       840
     cgaagcttga gtcctttcag taagcgcctt gctttgactc aagccatgaa taacggacgg       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page