(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE259

PENCW_13.PE259       Location/Qualifiers
FT   CDS_pept        join(complement(585602..585817),complement(584998..585423))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946650"
FT                   /orf_name="Pc16g02590"
FT                   /product="Pc16g02590 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP92929.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniParc:UPI0001831B0E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H745"
FT                   /transl_table=1
FT                   /translation="MAGGGSRYRHLSRDSAHRQAMLRNLVTSLFKHETITTTWPKAKEA
FT                   QRLAEKLITLGKKNTEASRRRALEIFYTPHEMLPKLFGPLRERYADRPGGYTRVLRVEP
FT                   REKNEYFSAKKGDKNAIREPKPQVKAPTAILELVDGPKDMRFAMTARTVAREREQGRDL
FT                   VHSLTRLNVKKVTQFRKDGVEVLERAISKLSLAKKQNDKLAKEGEVESKE"
     atggccggcg gcggaagcag ataccgccac ttaagccgcg actccgcgca tcgacaggcc        60
     atgctccgaa acctggtgac ctccctcttc aagcatgaga caattactac gacatggcct       120
     aaagccaaag aggcccagcg cctggccgag aagttgatca ccctgggcaa gaagaacacc       180
     gaagcgagtc ggcgacgagc attggagatt ttctacacac cacatgaaat gcttcccaaa       240
     ctcttcggtc ccctccgcga gcgttacgca gaccgaccag gcggttacac acgagtcctg       300
     cgcgtagaac cccgcgaaaa gaacgagtac ttctcggcca agaaaggcga caaaaacgcc       360
     atccgcgagc ctaaacccca ggtcaaggca cccactgcca ttctagagtt agtcgacggg       420
     ccgaaggaca tgcgtttcgc catgacggcg cggacggtgg cgcgcgagcg tgagcagggc       480
     cgtgatctcg tgcactcact cacgaggttg aatgtgaaga aggttacgca gttccggaag       540
     gacggtgttg aggtcttgga gcgggcgatt tccaagctca gtcttgccaa gaagcaaaat       600
     gataagctcg ctaaggaggg tgaggttgag tcgaaggaat aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page