(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE26

PENCW_13.PE26        Location/Qualifiers
FT   CDS_pept        join(59741..59858,59917..60000,60057..60166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977035"
FT                   /orf_name="Pc16g00260"
FT                   /product="Pc16g00260 protein"
FT                   /protein_id="CAP92696.1"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniParc:UPI0001831DB7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T4"
FT                   /transl_table=1
FT                   /translation="MPSSLSSSEHSGSVESNHSPSNSLQTKADPNMALHEQEPTAVNLQ
FT                   PGSRDTFSLRSIQHRDREGKVITDPDLSNPTRSRFERPLDTIRSFDAAIDAHRKQQRM"
     atgccgtcct cattgtcctc tagcgagcac tctggctcgg tcgagtcgaa ccacagcccc        60
     agcaattctc ttcaaaccaa agccgacccc aacatggccc tccatgaaca agaacccacc       120
     gccgtgaatc tccagccggg atctcgggat acattctcac tccgaagtat ccagcacagg       180
     gaccgggaag gaaaggtcat caccgacccc gatctctcca acccaacacg cagccgattc       240
     gagcgcccgt tagacactat ccgatcgttt gatgcagcca tcgacgcaca tcgcaaacag       300
     caacggatgt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page