(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE261

PENCW_13.PE261       Location/Qualifiers
FT   CDS_pept        join(588253..588511,588642..588820)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946651"
FT                   /orf_name="Pc16g02610"
FT                   /product="Pc16g02610 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP92931.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001831B10"
FT                   /db_xref="UniProtKB/TrEMBL:B6H747"
FT                   /transl_table=1
FT                   /translation="MGKGQPRGLNAARKLQSHRKDQRWADDHFKKRLLGTAYKSSPFGG
FT                   ASHAKGIVLEKVGVEAKQPNSAIRKCVKVQLIKNGKKVAAFVPNDGCLNFIDENDEVLL
FT                   AGFGRKGKAKGDIPGVRFKVVKVSGVGLAALWKEKKEKPRS"
     atgggtaaag gacagccccg tggtttgaac gccgcccgca agctccagtc gcaccgcaag        60
     gaccagcgct gggctgatga ccacttcaag aagcgccttc tcggaaccgc ctacaagtcc       120
     tcccccttcg gtggtgcttc ccacgccaag ggtatcgtcc tcgagaaggt cggtgttgag       180
     gccaagcagc ccaactccgc tatccgcaag tgtgtcaagg ttcagctcat caagaacggc       240
     aagaaggtcg ctgctttcgt ccccaatgac ggttgcttga acttcatcga tgagaacgac       300
     gaggtcctgc tcgccggttt cggtcgcaag ggtaaggcca agggtgatat tcccggtgtc       360
     cgtttcaagg tcgtcaaggt ctccggtgtc ggtctcgccg ctctctggaa ggagaagaag       420
     gagaagcccc gctcttaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page