(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE262

PENCW_13.PE262       Location/Qualifiers
FT   CDS_pept        join(complement(591374..591471),complement(590999..591294),
FT                   complement(590108..590945),complement(589966..590038))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946652"
FT                   /orf_name="Pc16g02620"
FT                   /product="Pc16g02620 protein"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP92932.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI0001831B11"
FT                   /db_xref="UniProtKB/TrEMBL:B6H748"
FT                   /transl_table=1
FT                   /translation="MPSSSLALTPGLGSFLKCLKTNPIDTSIETLISLLKRRQIRHSRS
FT                   CATATAYLLRSVISACRTTDSAKLIERVQSVGRRLMAAQPREMVVGNIVRRVLGLIRDE
FT                   AEDDRDAEFALSDIGSESQPQTPRAYDDASLPLDRDSPSFRAEDRSSRPPLTSMFSLLS
FT                   HPEPEISLPSTPGSSSPSGRFTGHGPSKDVRAEVLEGIGEIIDELGQVDDQIAAYALDH
FT                   IHSNEIILTHTSSTTVQKFLLKAAAKRKFTVIHAESYPNNHEATHATVSGSAVSDDDNL
FT                   GLEAFQKPLIEHGITVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRVIARA
FT                   AKVHQTPVVVVSGVYKLSPVYPFDFDSLIEYGDPSKVLPYEEGDLVDLVDVQNPIYDYV
FT                   PAELVDLYITNLGGHAPSYLYRIVSDHYRKEDISF"
     atgccgtctt cctcgttggc cctgacgccg ggcctgggct cattcctcaa gtgcctcaag        60
     acaaacccga tcgatacctc tattgagaca ctgatttcat tgctcaagcg acgtcaaatc       120
     cgccattccc gatcatgtgc cacagcaacc gcctatttgc tacggagtgt gatctccgca       180
     tgtcgcacaa cagattcggc aaagcttatt gagcgggtgc agagtgtggg caggcgcctg       240
     atggctgcgc aaccgcgcga gatggttgtg ggcaatattg tgcgccgggt cctgggtctt       300
     attcgtgacg aagctgaaga tgatcgcgac gctgaattcg ctctcagcga catcggctca       360
     gaaagccagc cacaaacacc ccgggcttat gacgatgcat ccttgccttt ggatcgcgac       420
     tccccttcct tccgagccga agacagatcc tctcgccctc ctctgacctc tatgttcagc       480
     cttctttccc atcctgaacc cgagatttca cttcccagca ccccgggatc ctcctccccg       540
     agtggacgct tcactggcca cggcccaagt aaagacgtcc gagctgaagt actggagggt       600
     attggcgaga tcattgatga actcggccag gtggacgatc agatcgctgc ctacgcattg       660
     gaccacatcc actctaacga aatcatcctc acccacacat cctcgaccac tgtccagaag       720
     ttcttgctca aagccgccgc aaagcgaaag ttcaccgtaa ttcacgccga gtcttacccg       780
     aataaccacg aggctacaca cgccacagtc agtggtagcg ctgtcagcga cgatgacaat       840
     ctcggcttgg aggctttcca aaagccactg atcgagcacg gcatcaccgt catcctcatc       900
     ccggactctg ccgtattcgc tctcatgtca cgagtcaaca aggttattct cggcacacac       960
     tccgtccttg ccaacggcgg ccttgtcgcc gcagctggca cccgtgtcat cgcccgtgct      1020
     gccaaggtcc accagacccc cgtcgtggtc gtgagcggcg tttacaagct cagccctgtc      1080
     tacccatttg acttcgactc gctcattgaa tacggtgacc caagcaaggt cctcccatac      1140
     gaggaaggtg atcttgtcga cctggtcgat gtccaaaacc ccatctatga ctacgttcct      1200
     gcagagcttg tcgatcttta catcactaac ctcggtggcc acgccccatc atacctttac      1260
     cgcattgtgt cagaccacta ccgcaaagaa gatatcagct tctaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page