(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE263

PENCW_13.PE263       Location/Qualifiers
FT   CDS_pept        join(592049..593453,593506..593648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824080"
FT                   /orf_name="Pc16g02630"
FT                   /product="Pc16g02630 protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAP92933.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831B12"
FT                   /db_xref="UniProtKB/TrEMBL:B6H749"
FT                   /transl_table=1
FT                   /translation="MNSLNILSSRVIGQSSSSSRHRSQSQGDGKRAPLPSDFSKLRSYS
FT                   EDNFRSLDPTEKSYNDGLPVGEDREEDAPYDLDEKTPLLHEAHKNGTLTARSTWRLITQ
FT                   RFFDAITETIKFILSTIAAPGVYLAQCFQADDGHYSLLAPVRKLRRSSADPTIRSAKGA
FT                   TRVEGRRRSGSTRKLRPQGSHESIVSTTSESDTDRRHVKNLSSGRNRPIKTKGHDPDPI
FT                   PEGEEHEHTPRRSIRIKLHNEESLKRQRQRRSQSADLGHPMPEGVSRVQGAVHLDSLKS
FT                   PTSPNIHRITKYPHSPTPPRPLLPPRVPSYTAPPRNARAPQKTLVLDLDETLIHSLAKG
FT                   GRMSSGHMVEVKLSIPTTTSLSPGGPQTTLGPQHPILYYVHKRPHCDEFLRKVSKWYKL
FT                   VIFTASVQEYADPVIDWLEQERKYFQGRLYRQHCTFRNGAYIKDLSSVEPDLSKVMILD
FT                   NSPMSYIFHEDNAIPIEGWINDPTDNGLLHLVPMLEALQYVTDVRALLALRRGELES"
     atgaactcgc tgaatatcct gtcctcgcga gtcattggcc aatcttccag ctcttcacgc        60
     catagatcgc agtctcaagg cgacggcaag cgtgcacctc taccgtcaga cttctcgaaa       120
     ctccgatctt atagcgagga taactttcgg tccctcgacc ccaccgaaaa gagctataac       180
     gacggactgc ccgtgggcga agatagagag gaggatgccc catatgactt agatgagaag       240
     acgccgttac tgcatgaagc tcacaagaat ggcacgctca ctgctcgaag tacttggcga       300
     ctgattaccc agcgattttt cgatgcgatc acggaaacca tcaaattcat cctatctacg       360
     attgctgcac ccggtgtata tttggctcag tgcttccaag ccgacgatgg tcactactcg       420
     ctccttgcgc ctgtccggaa attgcggcgc tcctctgccg acccaacgat ccggtcggct       480
     aaaggggcca cccgggtaga aggtcggcgt cgcagtggct ccacccggaa gctccgacct       540
     caaggctctc acgaatccat tgtatcaaca acctcagagt ccgacacgga tcgacggcat       600
     gtcaagaatc tctcaagtgg gaggaaccga cctatcaaga caaaaggcca cgatccagac       660
     ccaatcccag aaggggaaga gcacgagcac acgccccgtc ggtctatacg aatcaagctt       720
     cataatgagg aatctctcaa gagacagcga cagcgaagat cccagagtgc agatttagga       780
     catccaatgc ccgagggcgt ctctcgagtc caaggggctg ttcacctgga tagcttaaag       840
     tccccaacct ctcccaacat tcatcgcata accaagtacc cacactctcc aaccccaccg       900
     cggccacttc ttccaccacg agtaccttca tatactgcac ctccccgcaa tgccagagcc       960
     ccgcagaaga ccttggtgct ggatctcgac gagacgctaa tccactcgct cgctaagggt      1020
     ggccggatgt ccagtggtca catggtcgag gttaagctct cgatacccac gactacttca      1080
     ttgtccccgg gtggaccgca aacgacactg ggccctcagc atccaatcct gtactatgtc      1140
     cataaacggc cacactgcga tgagttcctg cgcaaggtca gcaagtggta taagcttgtc      1200
     atcttcacgg ccagtgtcca agagtatgcc gatcctgtca tcgactggct cgagcaggaa      1260
     agaaaatact tccaaggccg cttataccga caacattgca catttcgtaa cggggcatac      1320
     atcaaggacc tgagttctgt ggaaccggat ctgagcaagg tcatgattct ggataacagc      1380
     ccgatgagtt atattttcca cgaagataat gcgattccca tcgaaggctg gataaacgac      1440
     cccacggaca acggtctgct ccacttggtt cccatgctcg aagctctaca atatgtcacg      1500
     gatgtccgag ctttgttggc acttcgccgc ggtgaactcg aatcatga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page