(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE264

PENCW_13.PE264       Location/Qualifiers
FT   CDS_pept        join(complement(594838..594873),complement(594767..594792),
FT                   complement(594661..594681),complement(594106..594334),
FT                   complement(593945..594013))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946653"
FT                   /orf_name="Pc16g02640"
FT                   /product="Putative uncharacterized protein Pc16g02640 "
FT                   /protein_id="CAP92934.1"
FT                   /db_xref="UniParc:UPI0001831B13"
FT                   /db_xref="UniProtKB/TrEMBL:B6H750"
FT                   /transl_table=1
FT                   /translation="MAKRLLSPLECQAGSANQITTGGNQQGGVRSAGGKTGLCLASAAV
FT                   PPRQHYEAHCAGMTTSRAGHNAAKIVLPIIHHFLEGWFPRKPLNLLRSAANAAKEKAQR
FT                   LIFSRDNGRKSWHGFVAWDQRG"
     atggccaaga ggttactttc accattggag tgccaggctg gttccgccaa tcaaattacc        60
     acgggaggta atcagcaagg aggtgtcagg agtgctggtg gtaaaactgg gctctgtctc       120
     gcttcagcag cagttccgcc aagacagcat tacgaagcac attgtgcagg gatgacaacc       180
     tccagggctg ggcacaatgc agccaagatt gtattaccaa tcatacatca cttcctggaa       240
     ggttggtttc cgaggaaacc actcaattta cttcgcagtg ctgcgaatgc tgcgaaagaa       300
     aaggcccagc gtctgatatt cagcagagac aatggccgca aatcgtggca tggctttgtt       360
     gcttgggatc aacggggtta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page