(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE265

PENCW_13.PE265       Location/Qualifiers
FT   CDS_pept        join(595358..595978,596057..596340,596431..596788)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235074" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977317"
FT                   /orf_name="Pc16g02650"
FT                   /product="Pc16g02650 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92935.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001831B14"
FT                   /db_xref="UniProtKB/TrEMBL:B6H751"
FT                   /transl_table=1
FT                   /translation="MSIRRRTAHRRRAGDQRLRFDENGTFQISVFSDLHFAEGTITDLN
FT                   HCLGILTIFKDDEEDHKTTGVMRSVLSSEEAQLVVLNGDLISGEATQSSNSTLYVDRVV
FT                   APLVDLDLPWASTYGNHDSEINLDPEELFRRETEYRNSLTQRDILDPAAGITNYYLPIF
FT                   PHGASNDSIPVFILWFFDSQGGHYPLTENDDGKATKRQNWVDDTVIEWFVKANANLTST
FT                   YGQTIPSLAFVHIPVYAMRAFQETGVSPTTEPGINGERVQQQGYEPDSGYHYQDFPFIN
FT                   ALLNTTGLAATFSGHDHDNDWCFRWDSKLPNLNVTGNGMSMCYGRHTGYGGYGDRARGG
FT                   RQILLDERLLGDDIRTWIRMEDGSISGDVHLNATYGHDHYGLVERSIVNGQNGGLSPPC
FT                   LGVICLWICVFSGLISGFHLW"
     atgtctatcc gcaggcggac cgcgcatcga cgccgcgccg gagaccaaag gttacgattt        60
     gacgagaatg gcacattcca aatatcggtt tttagtgact tgcattttgc tgaaggtacg       120
     atcacagact tgaaccattg tttggggata ctaactatat tcaaagatga tgaagaggac       180
     cacaagacca caggggtgat gagaagcgtt ctttcttcag aagaagcgca actcgtggta       240
     cttaatggag atttaatctc tggcgaggca acacaaagct ccaactccac actttacgtt       300
     gatcgggttg ttgctccact agtcgacctt gatttaccat gggcgtcaac ttatgggaat       360
     catgacagcg agattaatct cgatcccgaa gagttgttcc gtcgagagac agaatatcga       420
     aacagcttaa cccagagaga cattctggat cccgctgccg gcatcacaaa ctattacctg       480
     ccaatatttc cgcatggggc ttcgaatgac agtatccccg tatttatctt gtggttcttt       540
     gacagccaag gtggtcatta tcccttgaca gagaatgatg atggaaaagc aaccaagagg       600
     cagaattggg tagatgacac agttattgaa tggtttgtaa aagcgaatgc aaacttaaca       660
     tctacctatg ggcagacgat cccatctcta gctttcgtcc atatcccagt ttatgcaatg       720
     cgtgctttcc aggaaactgg cgttagccca accaccgaac caggaatcaa cggagaacga       780
     gtccaacagc aaggctatga acccgattct ggctaccatt atcaagactt cccatttata       840
     aacgctctgc tgaacaccac ggggctggcg gcgactttta gtggccatga tcacgataat       900
     gactggtgct tcaggtggga tagtaagctt cccaatctca acgtgacggg aaatggtatg       960
     agcatgtgct acggccggca tacaggatat ggagggtatg gcgatcgggc gcgtggtgga      1020
     aggcagattt tgttggatga gcggttgctt ggggatgata tccggacatg gattcggatg      1080
     gaagatggat cgatttcagg cgatgttcat ctcaatgcga catacggcca tgatcattat      1140
     ggactggtgg agaggagtat cgtcaacggg caaaatggtg gtctttctcc cccatgcttg      1200
     ggtgttattt gtttgtggat atgtgtcttt tctgggctta tatctgggtt tcatttatgg      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page