(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE266

PENCW_13.PE266       Location/Qualifiers
FT   CDS_pept        join(598244..598343,598418..598665,598729..599178,
FT                   599249..599818)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977562"
FT                   /orf_name="Pc16g02660"
FT                   /product="Pc16g02660 protein"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAP92936.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI0001831B15"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I2"
FT                   /transl_table=1
FT                   /translation="MRLSGTWSISNGLIATLLFSTLTPAIELDLNDEQSIKDAASTSTY
FT                   SMMGWYYGNETGQIPGSFPEKWWEGSALFLALLQYWHFTGDTTYNSLMSEGMQWQSGEE
FT                   GDYMPSNYSSYLGNDDQMFWGLAAMMAAELKFPDVEDGFSWLSLAQGVFNTQTARWDTT
FT                   TCGGGLRWQLFPYQSGYTMKNSVSNGGLFQLAARLARYTDDDKYSKWAEKIWDWSTSSP
FT                   LVNNKTWNVADSTQMANDCADSGNYQWTYNYGAYLMGAVYMYNYTNGDEKWKKPVDGLL
FT                   GKTLKTFFPNGDVIEDVTCEPIKMCNFNEILFKGLTSSWLAFTTLLAPDTAAQIKPKLA
FT                   SSAEAAAKSCTGNNNNTCGITWYQNKWDGTTGMEQEISATNVFLANLINYNTGSFGPVT
FT                   SKTGGNSASDPNAGSENDDEKKMKPITTGDKAGASILTLIFVFGWAGAVAFMMLGG"
     atgcgcttgt ccggaacatg gtctatttct aatggcctca tcgcaacact cctcttttca        60
     acgttgacgc ctgcgatcga attagacctc aacgatgaac aatcaatcaa agatgccgca       120
     agtacgagta cttactccat gatgggatgg tattacggca acgaaactgg acaaatccct       180
     ggctctttcc ccgaaaaatg gtgggaagga tctgctcttt tcctcgcact gcttcagtac       240
     tggcacttta cgggcgacac gacctataac tctttgatga gcgaaggaat gcagtggcaa       300
     tcgggcgaag agggtgacta catgcccagc aattacagta gctatctggg aaatgacgac       360
     caaatgttct ggggtcttgc agccatgatg gccgccgagc tgaaattccc tgatgtcgag       420
     gacggattct cgtggctttc actcgcacag ggtgtattta acacccagac cgctcgatgg       480
     gatacaacaa cttgtggtgg tggtctgcgt tggcagctct tcccttacca atcagggtac       540
     actatgaaga actccgtatc caatggcggt ctgttccaac tcgctgcgcg cctcgcccgc       600
     tacacggatg atgacaagta ctcaaaatgg gccgagaaga tctgggactg gtctacttcc       660
     tcaccgctag tgaacaacaa gacctggaat gttgccgatt caacacaaat ggcaaatgac       720
     tgtgccgact ctggtaatta ccagtggact tacaactacg gagcatactt gatgggtgct       780
     gtctacatgt ataactatac aaatggagat gaaaagtgga agaaaccagt agacggcctc       840
     ctcggcaaaa ccctaaagac attcttcccg aacggggacg tcatcgaaga tgtcacttgt       900
     gagcctatca aaatgtgcaa tttcaacgag atcctcttca agggcctcac ctcgtcatgg       960
     cttgcattca caacactctt agcccccgac accgcggcgc agatcaagcc caaactcgcc      1020
     agctccgccg aagccgccgc aaagtcctgc acgggaaaca acaacaacac gtgcggtatc      1080
     acgtggtatc agaacaagtg ggacgggaca actggtatgg agcaagagat tagcgcaacg      1140
     aatgtcttcc ttgcgaattt gatcaactat aacaccggct cgtttgggcc tgtcacctcc      1200
     aagactggtg gaaacagcgc cagtgatccc aatgcgggct cagaaaatga tgatgagaag      1260
     aagatgaagc ctattaccac tggcgacaag gccggcgcca gtattttgac cttgattttt      1320
     gtgtttggtt gggctggtgc tgtggctttc atgatgctgg gtggttag                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page