(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE267

PENCW_13.PE267       Location/Qualifiers
FT   CDS_pept        600584..602140
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824330"
FT                   /orf_name="Pc16g02670"
FT                   /product="Pc16g02670 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92937.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B16"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I3"
FT                   /transl_table=1
FT                   /translation="MVAITWTDRQPDAVHEESYHVDETTALLASGKTKHGGAPTSDTLD
FT                   SSSGPDGDNDGNNDNDDEKKPLPIAQILLLCYARAVEPLAFFSIFPYVSQMVQDNGGLA
FT                   DADVGFYSGLIESMFSLTQAIVMIFWGQAADRFGRKPVLVSSLFGVTVATSLFGLAKTI
FT                   PQMIMFRCLAGVFAGTIVTIRTMVAEHSTPNTQARAFSWFAFSGNLGIFLGPLLGGALA
FT                   DPVRQYPGVFGAVHFFEKYPYALSSLVVASVGATAAVSSACFVEETLKKEPVTVGHDGE
FT                   EAASDVPTQSSDLSTWELLKSPGVGMVLYAYGHIMVLAFAFTAIIPVFWFTPVHLGGYG
FT                   FTPLQISLMMGLNGAAQATWLLLVFPPLQKKIGSNGVIRLCATGYPLFFLCCPLGNVLL
FT                   RIGTDGSVKAFWIILPITLAIGCGVSMSFTAIQLALNDVAPSPKVLGTLNALALTGVSA
FT                   LRAFCPALFTTLFALGARTQLAGGYAIWVLMLIIASGLSVTAKYLPEPEAARKRRSSQP
FT                   R"
     atggtcgcaa tcacatggac agatagacag ccagacgctg tacacgagga aagctaccat        60
     gtagatgaga ctacagctct cctagcgtcc ggcaagacta agcatggtgg cgcacccaca       120
     tcagacactc tggacagttc gtcagggcca gatggcgaca atgatggcaa taacgacaat       180
     gacgatgaga aaaagccctt gcccatagcc cagatcctgt tgctttgcta tgcgcgcgca       240
     gtcgagcccc tagccttctt ctccatcttc ccctatgtca gtcagatggt gcaggataac       300
     gggggtttgg cggacgcgga cgtcggcttc tacagcggac tgatcgagtc gatgttctcc       360
     ctaacgcagg ccatcgtcat gatattctgg ggacaagcag ccgaccgatt cggtcgcaag       420
     cccgtcctgg tctcctcctt gttcggcgtg actgtggcga caagcctctt tggcctggca       480
     aagaccatac cacagatgat catgtttagg tgtcttgctg gcgtctttgc tgggaccatc       540
     gtcaccatcc gcacgatggt ggccgagcac agcacgccca atacccaggc ccgggcgttt       600
     agctggttcg ccttcagcgg gaacttgggt attttcctgg gacctttatt gggtggtgca       660
     cttgctgacc cagtaagaca gtaccctggt gtcttcgggg ctgtccactt cttcgaaaaa       720
     tatccctacg cgctctcgag cttggtggtg gcgtccgtgg gagccactgc tgccgtgtct       780
     agtgcctgct ttgtcgaaga gacgttgaaa aaggagccgg ttacggtggg ccatgatggc       840
     gaggaggcag catccgatgt gccgacccag agcagtgatc tatcgacatg ggagctcctc       900
     aaatcgccgg gggttggtat ggtcctgtac gcgtacgggc atatcatggt gctcgccttt       960
     gctttcacgg ccattattcc cgtcttttgg ttcactcccg tacacctcgg agggtatgga      1020
     tttacgcctc tgcaaatctc gttgatgatg ggtctaaatg gtgccgcgca agctacgtgg      1080
     ctcctcctgg tgttcccccc actgcagaag aagatagggt cgaatggtgt gatacgtctc      1140
     tgcgccactg gctatccgtt attcttccta tgctgccctc ttggcaatgt actcctgcgg      1200
     attggcacgg atgggtctgt taaagccttc tggattatct tgccgatcac gctggcgatc      1260
     ggctgtggag tcagcatgag cttcacggcg attcagctcg ccctgaacga cgtcgcaccc      1320
     tcgccgaagg tacttggtac gctgaatgcg ctggccctga ctggtgttag cgcgctgaga      1380
     gccttctgcc ctgctctctt taccaccctc ttcgctctgg gggcgaggac acagctggcg      1440
     ggcggctatg ccatctgggt acttatgctc ataattgctt cgggtttatc cgttacagca      1500
     aaatacctgc cagagcccga ggcggcccgc aagcgccgga gcagccaacc gaggtga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page