(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE268

PENCW_13.PE268       Location/Qualifiers
FT   CDS_pept        join(603728..603893,603945..604256,604306..604720,
FT                   604792..605259,605316..605475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947668"
FT                   /orf_name="Pc16g02680"
FT                   /product="Pc16g02680 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92938.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B17"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I4"
FT                   /transl_table=1
FT                   /translation="MIQIHGVTSATETPHVSEKDAALAVVSDVAQEIDPVVEKRVLRKI
FT                   DWYLMPAMLIGYGMVYYDKAILGSAALFGMTTDLELSVKDYSTSPPTVDTSRLGWATSI
FT                   FYFGMLAGLYPMTFILQRFNIRTVLGPVVLVWAVICAATAGVSTWQGLYVQRFFLGFIE
FT                   SVIPTGFMTIVSGYYTQEEQALRQAWWFSGTGWFTIIGSALNYGFGQITSGSLKRWQYI
FT                   YILAGALTFLFGLWCCTMPNSPVSAWFLTPEERMVAVERLRKGQTGVRCQKIKLDQIKE
FT                   CLTDVKIYLVAIMMAAAYTINGAISGFGPLIVSTFGYDTLDSILFQFPVGGVCVIFIPL
FT                   CGYISTIVPNVRIPMLIACCLPVIAGCVMIWKSEWGYRPVTPVVGYALTGFFGPVVSLI
FT                   ITTGACNVAGATKKTVMAATVFVAYTVGNIIGPQLVKSDTKAQHYPELWTGMIICYCIT
FT                   IAAAVVLYLVLRRENRIRGQLDLDEVQRDKIAFDDLTDKQNPFFRYAL"
     atgattcaga tacatggtgt caccagcgcc actgaaaccc ctcatgtttc cgaaaaagat        60
     gcagcgctgg cagtggtgag cgatgtagct caggaaattg atccagtggt cgaaaaaagg       120
     gttctccgaa agatcgactg gtatttaatg cctgcgatgc ttataggata tggaatggtg       180
     tactatgaca aggcaatcct aggcagtgcc gccctctttg gtatgacgac cgacttggaa       240
     ttatcagtga aagactattc cacttctccc ccgacagttg acacttcccg gctcggttgg       300
     gcaacgtcaa tcttttactt tggaatgctt gcgggtctct acccaatgac atttattctt       360
     caaaggttca acattcggac tgtcctgggt cccgttgttc ttgtttgggc tgtgatatgt       420
     gccgccactg ccggtgtctc aacctggcaa ggtctttatg tacaacgatt cttccttggc       480
     ttcatcgaaa gtgtcatccc tacgggcttc atgaccatag tcagtgggta ttacactcaa       540
     gaagaacaag ctctcagaca ggcttggtgg ttttcaggga ccggttggtt tacaatcatt       600
     ggcagcgccc tgaattacgg gtttggtcag attacatctg gatctttgaa aagatggcag       660
     tatatctata ttcttgccgg tgcgcttacc ttcttatttg gcctgtggtg ttgcactatg       720
     ccgaactctc cagtctcggc ttggttcttg accccagaag aacgaatggt tgccgtggaa       780
     agattgcgaa agggacaaac cggtgtgagg tgtcagaaga taaagctcga ccagatcaaa       840
     gaatgtttga ccgatgtcaa gatctaccta gtggctatca tgatggcagc ggcgtatact       900
     atcaacggtg ccatctctgg gtttgggccc ttgattgtat cgaccttcgg ctacgacact       960
     cttgattcga tcctgttcca gtttcccgtt ggaggcgttt gtgtcatttt cattcccctc      1020
     tgtggctaca tttctactat cgtgcccaac gttcgcatac ctatgcttat tgcctgctgc      1080
     ttgcctgtta ttgccggttg cgtgatgatc tggaaatccg aatggggata ccgtcctgtc      1140
     accccagttg ttggttatgc cttgactggc ttctttggac cagtggttag cttgattatt      1200
     acaactggag cttgcaacgt tgcaggtgct acaaagaaga ccgtcatggc ggcaactgtg      1260
     ttcgtggcgt acactgtcgg caacattatc gggccccagt tggtaaaaag cgacaccaag      1320
     gcacagcatt atccggaatt gtggacgggt atgatcattt gttactgcat tacaatagcc      1380
     gctgcagttg tgctgtatct agtgcttcgt cgagagaatc gaatccgggg acaattagac      1440
     ctggatgaag tgcagcgaga caagattgcg tttgatgatc ttaccgacaa acagaacccc      1500
     tttttccgct atgctttata g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page