(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE27

PENCW_13.PE27        Location/Qualifiers
FT   CDS_pept        join(61674..61748,61808..61845,61975..62711,62765..63471)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823843"
FT                   /orf_name="Pc16g00270"
FT                   /product="Pc16g00270 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP92697.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831DB8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T5"
FT                   /transl_table=1
FT                   /translation="MKFSLVALATLAGVAVADLDPIVIKGSKFFYSSNDTQFTTSSGYI
FT                   DPLADPTACARDVPMLAKLRTNVIRTYAINASADHSECMKLLADAGIYVISDLSQPKLS
FT                   IDRSDPTWETDLFARYTSVVDELAQYNNTIGFFAGNEVANSVNTSDSSAFVKAAVRDTK
FT                   KYIKDKGYRPMGVGYATADVADIRADMADYFNCGEADESIDFWGYNIYSWCGESTYAKS
FT                   GYKDRTEEFANYSVPVFFAEYGCNEVTPREFTDVKALYGEPMADVWSGGIVYMYFQEAN
FT                   NYGLVSVVDSTSVSTLADFKYYSSQIASVNPTGVKKASYTPTNTALRSCPTVGSSWSAE
FT                   PSPLPPVADIQLCDCMYDASACVVADSLSSTKYSKLFSTVCGYTDCSGLTANATTGEYG
FT                   AYSMCSTKQQLAFALNKYYVEQNRAADACSFAGSATVKSVTKATGTCATQMKEAGTAGT
FT                   GTITTENTGIAGSGSASSTGSSTTSSSGAISMHSSSSFGSFQVAAYIATALLAGVGMIA
FT                   L"
     atgaagttct ccttggtagc actggcaacc ctggctgggg ttgctgttgc tgatttggat        60
     cccatcgtca tcaagggttc caagttcttc tattctagca atgacactca atttacgacc       120
     agcagtggct acattgaccc tctcgccgat cccaccgctt gtgcgcgtga tgttcccatg       180
     ctggcgaagc tgcgcaccaa cgttatccgt acctatgcca tcaacgcctc tgctgaccac       240
     tcggagtgta tgaagctctt ggcggacgcg ggtatttacg tgatctctga tctgtcccaa       300
     cccaagctat cgattgatcg aagcgatcct acgtgggaaa ccgatctttt tgcccgatac       360
     accagtgttg ttgatgagct ggcccagtac aacaacacca ttggtttctt cgctggaaat       420
     gaggttgcca acagcgtcaa tacttctgac tccagcgctt tcgtcaaggc cgccgttcgt       480
     gataccaaga agtacatcaa ggacaagggc taccgcccta tgggtgttgg atatgctacc       540
     gccgatgtgg cagacatccg tgcggacatg gctgattatt tcaactgcgg agaggccgac       600
     gagtctattg acttctgggg ctacaacatc tactcgtggt gcggtgaatc gacctacgcg       660
     aaatcgggat acaaggatcg caccgaagag ttcgccaact actccgtccc tgtcttcttc       720
     gccgagtacg gttgcaacga ggtcacgccc cgcgagttca ccgatgtgaa ggccctttat       780
     ggtgaaccta tggctgatgt ctggtccggt ggtatcgtgt acatgtactt ccaggaggcc       840
     aacaactacg gtctggtttc tgtcgtcgat agcaccagtg tcagcacttt ggccgacttc       900
     aagtactatt ccagccagat cgccagcgtc aaccccactg gtgtcaagaa ggcctcctac       960
     actcccacca acactgccct gcggagctgc cctactgtcg gatcctcgtg gtccgccgaa      1020
     ccttcccctc tgccccctgt cgccgacatc cagttgtgcg actgcatgta cgatgcctcc      1080
     gcctgcgttg tggccgattc cctctcctcg acgaagtact ccaagctgtt cagcactgtc      1140
     tgcggttaca ccgactgcag cggactgacc gccaatgcca ccaccggcga gtatggtgct      1200
     tacagcatgt gctcgaccaa gcagcaactt gcctttgctc tgaacaagta ctacgttgag      1260
     cagaaccgtg ctgccgatgc ttgtagcttc gccgggtctg caaccgtcaa gtcggtgacc      1320
     aaggccactg gcacttgcgc tacacagatg aaggaggctg gcactgctgg aaccggaact      1380
     attaccactg agaacactgg catcgcgggc tctggctctg cttcctcgac gggctcgtcg      1440
     accacatcta gcagcggcgc tatcagcatg cactccagct cttcgttcgg ctctttccag      1500
     gtggctgcct acatcgccac cgcactcctg gcgggtgttg gaatgatcgc cctgtag         1557
//

If you have problems or comments...

PBIL Back to PBIL home page